DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ppi1 and Krt19

DIOPT Version :9

Sequence 1:	NP_733345.2	Gene:	Ppi1 / 43581	FlyBaseID:	FBgn0051025	Length:	998	Species:	Drosophila melanogaster
Sequence 2:	NP_032497.1	Gene:	Krt19 / 16669	MGIID:	96693	Length:	403	Species:	Mus musculus

Alignment Length:	96	Identity:	22/96 - (22%)
Similarity:	45/96 - (46%)	Gaps:	5/96 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   458 EAIVKDYQLLRRSIRESNTKATQSATKNPTAQEGSAQPQDLAKVFTELRDLFNVKAADENQKIQD 522
            |::.::...|:::..|..|..........:.:..|....||||:.:|:|..:.: .|::|:|
Mouse   208 ESLKEELAYLKKNHEEEITALRSQVGGQVSVEVDSTPGVDLAKILSEMRSQYEI-MAEKNRK--- 268

  Fly   523 ICAEACALAKSHKKSKNRPASPERTKAGKTD 553
             .|||..||:..:.:.......|:.:..||:
Mouse   269 -DAEATYLARIEELNTQVAVHSEQIQISKTE 298

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ppi1	NP_733345.2	DUF4788	108..>294	CDD:292651
Ppi1	NP_733345.2	DUF4776	371..848	CDD:292622	22/96 (23%)
Krt19	NP_032497.1	Head	1..82
		Filament	82..393	CDD:278467	22/96 (23%)
		Coil 1A	83..118
		Linker 1	119..136
		Coil 1B	137..228		4/19 (21%)
		Prefoldin	182..307	CDD:238453	22/96 (23%)
		Linker 12	229..251		4/21 (19%)
		BAR	247..>402	CDD:299863	17/57 (30%)
		Necessary for interaction with PNN. /evidence=ECO:0000250	247..393		17/57 (30%)
		Coil 2	252..390		13/52 (25%)
		Rod-like helical tail	391..403
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_28M49
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900