DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppi1 and Krt15

DIOPT Version :9

Sequence 1:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_032495.2 Gene:Krt15 / 16665 MGIID:96689 Length:456 Species:Mus musculus


Alignment Length:315 Identity:54/315 - (17%)
Similarity:111/315 - (35%) Gaps:93/315 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 DGRLAGGQERGCFPNMNVDLQDLSFMSTSSIDPCVGFMPSDTEVAQDSPPCSEDRAQDSFQCQDS 306
            ||.|..|.|:       |.:|:|:....|.:|.......::||:        |.:.:|.:|.|. 
Mouse    90 DGGLLSGNEK-------VTMQNLNDRLASYLDKVRALEQANTEL--------EVKIRDWYQKQS- 138

  Fly   307 PPRLIDMAGPYPVYSCPNVDDDCVTFEPPAGPATQFSSCQKNVLGEGNANRLCQKHSSPRLRQMH 371
                                        ||.|...:|...| .:.|.....|.....:.|: .:.
Mouse   139 ----------------------------PASPDRDYSHYFK-TMEEIRDKILAATIDNSRV-VLE 173

  Fly   372 ISNTRSCVLCGEDVSWLPKVAACPCCGYKPVPEFKERPYDEQATAQQIL---LDHLENPVENLSF 433
            |.|.|   |..:|                    |:.: |:.:.|.:|.:   ::.|...::.|:.
Mouse   174 IDNAR---LAADD--------------------FRLK-YENELTLRQGVEADINGLRRVLDELTL 214

  Fly   434 DMGSVEGCSANEEHGVPEPTSEAFEAIVKDYQLLRRSIRESNTKATQSATKNPTAQEGSAQPQDL 498
            ....:|               ...|.:.::...|:::..|...:.:.........:..:|...||
Mouse   215 ARTDLE---------------MQIEQLNEELAYLKKNHEEEMKEFSSQLAGQVNVEMDAAPGVDL 264

  Fly   499 AKVFTELRDLFNVKAADENQKIQDICAEACALAKSHKKSKNRPASPERTKAGKTD 553
            .::..|:|:.:.. .|::|::  |:  ||...:|:.:.:|...::.|..:..||:
Mouse   265 TRMLAEMREQYEA-IAEKNRR--DV--EAWFFSKTEELNKEVASNTEMIQTSKTE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651 12/51 (24%)
DUF4776 371..848 CDD:292622 30/186 (16%)
Krt15NP_032495.2 Head 1..97 3/6 (50%)
Filament 97..409 CDD:278467 50/308 (16%)
Coil 1A 98..133 9/49 (18%)
Linker 1 134..152 7/47 (15%)
Coil 1B 153..244 18/130 (14%)
Linker 12 245..264 1/18 (6%)
Coil 2 265..406 12/55 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.