DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppi1 and KRT28

DIOPT Version :9

Sequence 1:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_853513.2 Gene:KRT28 / 162605 HGNCID:30842 Length:464 Species:Homo sapiens


Alignment Length:262 Identity:48/262 - (18%)
Similarity:88/262 - (33%) Gaps:74/262 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 CVGFMPSDTEVAQDSPPCSEDRAQDSFQCQDSPPRLIDMA---------GPYPVY---SCPNVDD 327
            |:||..|:..:...:...:.....|.........|.::.|         |.|..|   ||..:|.
Human    71 CIGFAGSEGGLLSGNEKVTMQNLNDRLASYLDNVRALEEANAELERKIKGWYEKYGPGSCRGLDH 135

  Fly   328 DC----VTFEPPAGPATQFSSCQKNVLGEGNANRLCQKHSSPRLRQMHISNTRSCVLCGEDVSWL 388
            |.    :|.|.........::...||:                   :.|.|.|   |..:|    
Human   136 DYSRYHLTIEDLKNKIISSTTTNANVI-------------------LQIDNAR---LAADD---- 174

  Fly   389 PKVAACPCCGYKPVPEFKERPYDEQATAQQILLDHLENPVENLSFDMGSVEGCSANEEHGVPEPT 453
                            |:.: |:.:.|..|    ::|..:..|...:..:..|..::|       
Human   175 ----------------FRLK-YENELTLHQ----NVEADINGLRRVLDELTLCRTDQE------- 211

  Fly   454 SEAFEAIVKDYQLLRRSIRESNTKATQSATKNPTAQEGSAQP-QDLAKVFTELRDLFNVKAADEN 517
             ..:|::.::...|::: .|...||.|.|.......|.:|.| .|||.:...:|..:.. .|::|
Human   212 -LQYESLSEEMTYLKKN-HEEEMKALQCAAGGNVNVEMNAAPGVDLAVLLNNMRAEYEA-LAEQN 273

  Fly   518 QK 519
            :|
Human   274 RK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651 4/18 (22%)
DUF4776 371..848 CDD:292622 30/150 (20%)
KRT28NP_853513.2 Head. /evidence=ECO:0000255 1..85 4/13 (31%)
Filament 85..396 CDD:278467 44/248 (18%)
Coil 1A. /evidence=ECO:0000255 86..121 3/34 (9%)
Linker 1. /evidence=ECO:0000255 122..143 6/20 (30%)
Coil 1B. /evidence=ECO:0000255 144..235 20/146 (14%)
Linker 12. /evidence=ECO:0000255 236..258 8/21 (38%)
Coil 2. /evidence=ECO:0000255 259..397 4/18 (22%)
Tail. /evidence=ECO:0000255 398..464
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..464
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.