DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp14b and rpp14

DIOPT Version :10

Sequence 1:NP_651769.1 Gene:Rpp14b / 43578 FlyBaseID:FBgn0039744 Length:112 Species:Drosophila melanogaster
Sequence 2:XP_073792600.1 Gene:rpp14 / 553721 ZFINID:ZDB-GENE-050522-182 Length:132 Species:Danio rerio


Alignment Length:101 Identity:19/101 - (18%)
Similarity:41/101 - (40%) Gaps:23/101 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYYFDIKLKLRDPTAVALTPSLFRSCVLDALDSFFCEEKPT--LEIVKFCAQQHRVIFRVPEQLH 66
            |:|..|.|.|..... .::.:.|:..::..:...:.|...:  .:::||          .|::|.
Zfish    18 YHYMKISLVLEKENR-NISDAQFKQLIISGVKDLYGEIGASFPFDLLKF----------DPKELT 71

  Fly    67 DMTRI----------SIELIGHYQQIPCHFEILETS 92
            .:.|:          ::.|:|.||...|.|.:.:.|
Zfish    72 GILRVYNSGLVKLWSALTLLGSYQNEACAFRVTQVS 107

Return to query results.
Submit another query.