DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp14b and Rpp14

DIOPT Version :10

Sequence 1:NP_651769.1 Gene:Rpp14b / 43578 FlyBaseID:FBgn0039744 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001101842.2 Gene:Rpp14 / 361020 RGDID:1305436 Length:122 Species:Rattus norvegicus


Alignment Length:93 Identity:21/93 - (22%)
Similarity:39/93 - (41%) Gaps:3/93 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ANYYYFDIKLKLRDPTAVALTPSLFRSCVLDALDSFFCEEKPTL--EIVKFCAQQHRVIFRVPEQ 64
            :.|:|..:.|:.:: ..|.|..:.|:..::.||...|.|....|  :::.:.......|.||...
  Rat    15 SEYHYMKVCLEFQE-HGVGLNGAQFKQLLVSALKDLFGEVGAALPVDVLTYDETTLSAILRVCSS 78

  Fly    65 LHDMTRISIELIGHYQQIPCHFEILETS 92
            .......|:.|.|.|:...|.|.:.:.|
  Rat    79 GLAKLWSSLTLFGAYKGKKCAFRVSQVS 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp14bNP_651769.1 None
Rpp14NP_001101842.2 RNase_P_Rpp14 28..106 CDD:460379 17/78 (22%)

Return to query results.
Submit another query.