DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-A and XRCC2

DIOPT Version :9

Sequence 1:NP_524583.1 Gene:spn-A / 43577 FlyBaseID:FBgn0003479 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001330643.1 Gene:XRCC2 / 836573 AraportID:AT5G64520 Length:378 Species:Arabidopsis thaliana


Alignment Length:226 Identity:43/226 - (19%)
Similarity:86/226 - (38%) Gaps:64/226 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 IETGSITEIFGEFRCGKTQLCHTLAVTCQLPIS----QKGGEGK-CMYIDTENTFRPERLAAIAQ 173
            :..|::.||.|.....|||:....|::|.||.:    ..||.|| .:::|.:..|...||:.:. 
plant    40 LRAGNVVEITGASTSAKTQILIQAAISCILPKTWNGIHYGGLGKLVLFLDLDCRFDVLRLSQML- 103

  Fly   174 RYKLNESEVLDNVAFTRAHNS--------DQQTKLI----------------------------- 201
            :::|.::..|.|.|:.:...|        :::||.:                             
plant   104 KHRLLQANWLGNGAWWQLEESNVKSCKSAEEKTKTVFDEELYASCMKRFLYVRCYDSLELLSSLK 168

  Fly   202 --------------QMAAGMLFESRYALLIVDSAMALYRSDYIGRGELAARQNHLGLFL-RMLQR 251
                          |.|.|    |:..:|::||..|.:.:|.:.........|...|.| .:::.
plant   169 YFTVLQTLHYRIQQQEACG----SQVGVLMIDSIGAFHWTDRLSSSLALETHNRKSLSLTNVVET 229

  Fly   252 LADEFGVAVVITNQVTASLDGAPGMFDAKKP 282
            :..|....:::.:.|..:..|.  :::.|.|
plant   230 IVQELKKLLLVHSLVVLATKGT--IYEEKYP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-ANP_524583.1 recomb_RAD51 22..335 CDD:274048 43/226 (19%)
HHH_5 30..77 CDD:291205
Rad51_DMC1_radA 99..331 CDD:238543 43/226 (19%)
XRCC2NP_001330643.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.