Sequence 1: | NP_524583.1 | Gene: | spn-A / 43577 | FlyBaseID: | FBgn0003479 | Length: | 336 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001330643.1 | Gene: | XRCC2 / 836573 | AraportID: | AT5G64520 | Length: | 378 | Species: | Arabidopsis thaliana |
Alignment Length: | 226 | Identity: | 43/226 - (19%) |
---|---|---|---|
Similarity: | 86/226 - (38%) | Gaps: | 64/226 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 114 IETGSITEIFGEFRCGKTQLCHTLAVTCQLPIS----QKGGEGK-CMYIDTENTFRPERLAAIAQ 173
Fly 174 RYKLNESEVLDNVAFTRAHNS--------DQQTKLI----------------------------- 201
Fly 202 --------------QMAAGMLFESRYALLIVDSAMALYRSDYIGRGELAARQNHLGLFL-RMLQR 251
Fly 252 LADEFGVAVVITNQVTASLDGAPGMFDAKKP 282 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
spn-A | NP_524583.1 | recomb_RAD51 | 22..335 | CDD:274048 | 43/226 (19%) |
HHH_5 | 30..77 | CDD:291205 | |||
Rad51_DMC1_radA | 99..331 | CDD:238543 | 43/226 (19%) | ||
XRCC2 | NP_001330643.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |