DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-A and DMC1

DIOPT Version :9

Sequence 1:NP_524583.1 Gene:spn-A / 43577 FlyBaseID:FBgn0003479 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_188928.2 Gene:DMC1 / 821860 AraportID:AT3G22880 Length:344 Species:Arabidopsis thaliana


Alignment Length:339 Identity:165/339 - (48%)
Similarity:221/339 - (65%) Gaps:7/339 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EKLTNVQ-AQQEEEEEEGPL--SVTKLIGGSITAKDIKLLQQASLHTVESVANATKKQLMAIPGL 63
            |:.:.:| .::||.:|:..|  .:.|||...|.|.|:|.||:|.:||...:...|||.|..|.||
plant     8 EETSQMQLVEREENDEDEDLFEMIDKLIAQGINAGDVKKLQEAGIHTCNGLMMHTKKNLTGIKGL 72

  Fly    64 GGGKVEQIITEANKLVPLGFLSARTFYQMRADVVQLSTGSKELDKLLGGGIETGSITEIFGEFRC 128
            ...||::|...|.|:|..|:::.......|..||:::||.:.||.||||||||.:|||.|||||.
plant    73 SEAKVDKICEAAEKIVNFGYMTGSDALIKRKSVVKITTGCQALDDLLGGGIETSAITEAFGEFRS 137

  Fly   129 GKTQLCHTLAVTCQLPISQKGGEGKCMYIDTENTFRPERLAAIAQRYKLNESEVLDNVAFTRAHN 193
            |||||.|||.||.|||.:.|||.||..|||||.||||:|:..||:|:.::...||||:.:.||:.
plant   138 GKTQLAHTLCVTTQLPTNMKGGNGKVAYIDTEGTFRPDRIVPIAERFGMDPGAVLDNIIYARAYT 202

  Fly   194 SDQQTKLIQMAAGMLFESRYALLIVDSAMALYRSDYIGRGELAARQNHLGLFLRMLQRLADEFGV 258
            .:.|..|:...|..:.|..:.:|||||.:||:|.|:.||||||.||..|...|..|.::|:||.|
plant   203 YEHQYNLLLGLAAKMSEEPFRILIVDSIIALFRVDFTGRGELADRQQKLAQMLSRLIKIAEEFNV 267

  Fly   259 AVVITNQVTASLDGAPGMF--DAKKPIGGHIMAHSSTTRLYLRKGKGETRICKIYDSPCLPESEA 321
            ||.:||||.|  |...|||  |.|||.|||::||::|.||..|||||:||:||:||:|.|.|:||
plant   268 AVYMTNQVIA--DPGGGMFISDPKKPAGGHVLAHAATIRLLFRKGKGDTRVCKVYDAPNLAEAEA 330

  Fly   322 MFAILPDGIGDARE 335
            .|.|...||.||::
plant   331 SFQITQGGIADAKD 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-ANP_524583.1 recomb_RAD51 22..335 CDD:274048 159/314 (51%)
HHH_5 30..77 CDD:291205 20/46 (43%)
Rad51_DMC1_radA 99..331 CDD:238543 127/233 (55%)
DMC1NP_188928.2 PLN03187 1..344 CDD:215620 165/337 (49%)
HHH_5 38..86 CDD:291205 20/47 (43%)
Rad51_DMC1_radA 108..339 CDD:238543 126/232 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62165
OrthoDB 1 1.010 - - D877394at2759
OrthoFinder 1 1.000 - - FOG0001571
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100483
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.