DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-A and Rad51c

DIOPT Version :9

Sequence 1:NP_524583.1 Gene:spn-A / 43577 FlyBaseID:FBgn0003479 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_038942551.1 Gene:Rad51c / 497976 RGDID:1563765 Length:402 Species:Rattus norvegicus


Alignment Length:340 Identity:89/340 - (26%)
Similarity:143/340 - (42%) Gaps:75/340 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AKDIKLLQQASLHTVE----------------SVANATKKQLMAIPGLGGGKVEQIITEANKLVP 80
            :|::.:.::.:|.|::                ||||   |:..|:..|     ||..|:      
  Rat    74 SKEVGISKEEALETLQILRRECLTNKPRCAGTSVAN---KKCTALELL-----EQEHTQ------ 124

  Fly    81 LGFLSARTFYQMRADVVQLSTGSKELDKLLGGGIETGSITEIFGEFRCGKTQLCHTLAVTCQLPI 145
             ||               :.|....||.:|||||.....||:.|....||||||..|||..|:|.
  Rat   125 -GF---------------IITFCSALDNILGGGIPLMKTTEVCGVPGVGKTQLCMQLAVDVQIPE 173

  Fly   146 SQKGGEGKCMYIDTENTFRPERLAAIA------------------QRYKLNE---SEVLDNVAFT 189
            ...|..|:.::||||.:|..:|:.::|                  |:..|.:   ..:|.::.:.
  Rat   174 CFGGVAGEAVFIDTEGSFMVDRVVSLATACIQHLHLIAGTHTEEEQQKALKDFTLENILSHIYYF 238

  Fly   190 RAHNSDQQTKLIQMAAGMLFE-SRYALLIVDSAMALYRSDYIGRGELAARQNHLGLFLRMLQRLA 253
            |.|:..:....:.:....|.: |:..|:|:|.....:|.|.   .:|..|...|....:.|..||
  Rat   239 RCHDYTELLAQVYLLPDFLSDHSKVQLVIIDGIAFPFRHDL---DDLFLRTRLLNGLAQQLISLA 300

  Fly   254 DEFGVAVVITNQVTASLDGAPGMFDAKKPIGGHIMAHSSTTRLYLRKGKGETRICKIYDSPCLPE 318
            ::..:||::|||:|..:|....   :..|..|....|::|.||... .:.:.|...:|.||...|
  Rat   301 NKHRLAVILTNQMTTKIDKNQA---SLVPALGESWGHAATIRLIFH-WEQKQRFATLYKSPSQKE 361

  Fly   319 SEAMFAILPDGIGDA 333
            |...|.|.|.|..||
  Rat   362 STVPFQITPQGFRDA 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-ANP_524583.1 recomb_RAD51 22..335 CDD:274048 89/340 (26%)
HHH_5 30..77 CDD:291205 13/60 (22%)
Rad51_DMC1_radA 99..331 CDD:238543 72/253 (28%)
Rad51cXP_038942551.1 Sms 97..>166 CDD:223993 29/98 (30%)
Rad51C 145..357 CDD:410900 56/218 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.