DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-A and rad51d

DIOPT Version :9

Sequence 1:NP_524583.1 Gene:spn-A / 43577 FlyBaseID:FBgn0003479 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001005687.1 Gene:rad51d / 448189 XenbaseID:XB-GENE-1014974 Length:320 Species:Xenopus tropicalis


Alignment Length:292 Identity:76/292 - (26%)
Similarity:119/292 - (40%) Gaps:68/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ITAKDI-KLLQQASL--HTVESVANATKKQLMAIPGLGGGKVEQIITEANKLVPLGFLSARTFYQ 91
            :.|.|: :|.::.||  .|:.:|......|..|.|..|                     |..:.:
 Frog    31 LVASDLEELARKCSLSYKTLMAVRRVLLAQYSAFPSSG---------------------ADVYEE 74

  Fly    92 MRADVVQLSTGSKELDKLLGGGIETGSITEIFGEFRCGKTQLCHTLAVTCQLPISQKGGEGKCMY 156
            :::....|.||:::||.||..|:.||.:|||.|....||||.|.::||.....:.|     ..:|
 Frog    75 LKSSTAILPTGNRKLDILLDSGLYTGEVTEIAGAAGSGKTQTCQSIAVNVAYNLKQ-----TVLY 134

  Fly   157 IDTENTFRPERLAAIAQ-RYKLNESEV--LDNVAFTRA--------------HNSDQQTKLIQMA 204
            :||.......||..:.| |.|..:.:|  |..:...|.              |...||  |::..
 Frog   135 VDTTGGLTASRLLQLVQSRTKSEDEQVASLQRIEVIRVFDIYKLFDAFQDLRHQISQQ--LLRSG 197

  Fly   205 AGMLFESRYALLIVDSAMALYRSDYIGR---GELAARQNHLGLFLRMLQRLADEFGVAVVITNQV 266
            ..:      .|:||||..|:......|:   |.....|     ..|.||.||.::.:|::|:|.:
 Frog   198 EPL------RLVIVDSVCAVIYPMLGGKHTEGMAIMMQ-----LARELQTLAHDYHLAILISNSI 251

  Fly   267 TASLDGAPGMFDAKKPIGGHIMAHSSTTRLYL 298
            |.  |||.|    .:|..|...:...:||:.|
 Frog   252 TK--DGATG----NRPALGRSWSFVPSTRILL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-ANP_524583.1 recomb_RAD51 22..335 CDD:274048 76/292 (26%)
HHH_5 30..77 CDD:291205 11/49 (22%)
Rad51_DMC1_radA 99..331 CDD:238543 64/220 (29%)
rad51dNP_001005687.1 P-loop_NTPase 82..298 CDD:393306 64/220 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.