DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-A and spn-B

DIOPT Version :9

Sequence 1:NP_524583.1 Gene:spn-A / 43577 FlyBaseID:FBgn0003479 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_476740.1 Gene:spn-B / 41746 FlyBaseID:FBgn0003480 Length:341 Species:Drosophila melanogaster


Alignment Length:337 Identity:94/337 - (27%)
Similarity:142/337 - (42%) Gaps:67/337 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ITAKDIKLL--QQASLHT---------VESVANATKKQLMAIPGLGGGKVEQIITEANKLVPLGF 83
            :|...::.|  :|.||||         |..:.:|..|.|..:|                      
  Fly    28 LTTPKVRFLDTRQQSLHTIVRKCTPDDVRVLKDAAAKWLAEMP---------------------- 70

  Fly    84 LSARTFYQMRADV--VQLSTGSKELDKLLGGGIETGSITEIFGEFRCGKTQLCHTLAVTCQLPIS 146
            .||.:.::...:|  .::|.|...||:..|||:.|..|||:.|....|||||...|::..||| .
  Fly    71 QSADSLFKPLVNVRWSRVSFGCSALDRCTGGGVVTRGITELCGAAGVGKTQLLLQLSLCVQLP-R 134

  Fly   147 QKGGEGK-CMYIDTENTFRPERL----AAIAQRYKLNESEVLDNVAFTRAHNSDQQ--TKLIQMA 204
            :.||.|| ..||.||::|...||    .|..:|:...|...|.|: |...|...:.  ..:|...
  Fly   135 ELGGLGKGVAYICTESSFPARRLLQMSKACEKRHPEMELNFLGNI-FVENHIEAEPLLACVINRI 198

  Fly   205 AGMLFESRYALLIVDSAMALYR--SDYIGRGELAARQNHLGLFLRMLQRLADEFGVAVVITNQVT 267
            ..::.:....|:|:||..|::|  :||:      .|..|:......|...||::..|||..||| 
  Fly   199 PRLMQQHGIGLIIIDSVAAIFRLYNDYL------ERARHMRRLADALLSYADKYNCAVVCVNQV- 256

  Fly   268 ASLDGAPGMFDAKKPIGGHIMAHSSTTRLYLRKGKGETRI---------CKIYDSPCLPESEAMF 323
            |:.||...:     |..|...||...|||.:.:...:.|:         .:|..||..|...|.|
  Fly   257 ATRDGQDEI-----PCLGLQWAHLGRTRLRVSRVPKQHRMGDQLITVRKLEILYSPETPNDFAEF 316

  Fly   324 AILPDGIGDARE 335
            .|..:|:.:..|
  Fly   317 LITAEGVVNVPE 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-ANP_524583.1 recomb_RAD51 22..335 CDD:274048 93/335 (28%)
HHH_5 30..77 CDD:291205 12/57 (21%)
Rad51_DMC1_radA 99..331 CDD:238543 78/249 (31%)
spn-BNP_476740.1 Rad51 87..323 CDD:285604 77/249 (31%)
Rad51_DMC1_radA 88..324 CDD:238543 78/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445396
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.