DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-A and rad51d

DIOPT Version :9

Sequence 1:NP_524583.1 Gene:spn-A / 43577 FlyBaseID:FBgn0003479 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_996959.2 Gene:rad51d / 404608 ZFINID:ZDB-GENE-040426-2490 Length:327 Species:Danio rerio


Alignment Length:300 Identity:84/300 - (28%)
Similarity:127/300 - (42%) Gaps:63/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IKLLQQASLHTVESVAN------ATK-----KQLMAIPGLGGGKVEQIITEANKLVPLGFLSART 88
            ||.||...:.|||...:      |.|     |.|:|        |.:::.......|:.  .|..
Zfish    17 IKALQTEDIRTVEDFVSWNPEELAQKCSLSYKALVA--------VRRVLLAQYTAYPIS--GADL 71

  Fly    89 FYQMRADVVQLSTGSKELDKLLGGGIETGSITEIFGEFRCGKTQLCHTLAVTCQLPISQKGGEGK 153
            :.::.:....|||||..|||||..|:.||.|||:.|....||||:|.::||.....:.|     .
Zfish    72 YEELLSSTAILSTGSPSLDKLLDSGLYTGEITELTGSPGSGKTQVCFSVAVNISHQLKQ-----T 131

  Fly   154 CMYIDTENTFRPERLAAIAQRYKLNESE------------VLDNVAFTRAHNSDQQTKLIQMAAG 206
            .:||||:......||..:.|....||.|            |.|..:......:.:.|.|.:.:.|
Zfish   132 VVYIDTKGGMCANRLLQMLQTKTSNEQEQMEALQKIKVFRVFDVFSLLACLQNLRSTGLQKTSVG 196

  Fly   207 MLFESRYALLIVDSAMALYRSDYIGRGELAARQNHLGLFLRM-----LQRLADEFGVAVVITNQV 266
               ......|:|||..|:. |..:|     .:||. |:.|.|     |:.:|.:|.:||::||.|
Zfish   197 ---GGSVKALMVDSVSAVL-SPILG-----GKQNE-GMSLLMQVAGELKMIAKDFNIAVLVTNHV 251

  Fly   267 TASLDG--APGMFDAKKPIGGHIMAHSSTTRLYLRKGKGE 304
            |...:|  ..|:        |...:|...||:.|::.:.|
Zfish   252 TKDGNGQLKAGL--------GLSWSHVPRTRVLLQRVENE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-ANP_524583.1 recomb_RAD51 22..335 CDD:274048 83/299 (28%)
HHH_5 30..77 CDD:291205 13/52 (25%)
Rad51_DMC1_radA 99..331 CDD:238543 68/224 (30%)
rad51dNP_996959.2 P-loop_NTPase 82..300 CDD:304359 68/224 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.