DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-A and Dmc1

DIOPT Version :9

Sequence 1:NP_524583.1 Gene:spn-A / 43577 FlyBaseID:FBgn0003479 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001124039.1 Gene:Dmc1 / 362960 RGDID:1307611 Length:340 Species:Rattus norvegicus


Alignment Length:337 Identity:171/337 - (50%)
Similarity:221/337 - (65%) Gaps:10/337 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QAQQEE---EEEEGPL--SVTKLIGGSITAKDIKLLQQASLHTVESVANATKKQLMAIPGLGGGK 67
            |..|||   ::||..|  .:..|....|...|||.|:...:.|::.:...|::.|..:.||...|
  Rat     5 QVVQEESGFQDEEESLFQDIDLLQKHGINMADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAK 69

  Fly    68 VEQIITEANKLVPLGFLSARTFYQMRADVVQLSTGSKELDKLLGGGIETGSITEIFGEFRCGKTQ 132
            ||:|...||||:..|||:|..:.:.|..|..::|||:|.|||||||||:.:|||.|||||.||||
  Rat    70 VEKIKEAANKLIEPGFLTAFQYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQ 134

  Fly   133 LCHTLAVTCQLPISQKGGEGKCMYIDTENTFRPERLAAIAQRYKLNESEVLDNVAFTRAHNSDQQ 197
            |.|||.||.|||.:.....||.::|||||||||:||..||.|:.::...|||||.:.||:.|:.|
  Rat   135 LSHTLCVTAQLPGADGYSGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQ 199

  Fly   198 TKLIQMAAGMLFESR--YALLIVDSAMALYRSDYIGRGELAARQNHLGLFLRMLQRLADEFGVAV 260
            .:|:...|....|..  :.||||||.|||:|.|:.||||||.||..|...|..||::::|:.|||
  Rat   200 MELLDYVAAKFHEEAGIFKLLIVDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAV 264

  Fly   261 VITNQVTASLDGAPGMF--DAKKPIGGHIMAHSSTTRLYLRKGKGETRICKIYDSPCLPESEAMF 323
            .:|||:||. .||...|  |.||||||||:||:||||:.||||:||.||.||||||.:||:||.|
  Rat   265 FVTNQMTAD-PGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATF 328

  Fly   324 AILPDGIGDARE 335
            ||...|||||:|
  Rat   329 AITTGGIGDAKE 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-ANP_524583.1 recomb_RAD51 22..335 CDD:274048 163/316 (52%)
HHH_5 30..77 CDD:291205 15/46 (33%)
Rad51_DMC1_radA 99..331 CDD:238543 134/235 (57%)
Dmc1NP_001124039.1 recomb_DMC1 24..338 CDD:131292 161/314 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62165
OrthoDB 1 1.010 - - D357659at33208
OrthoFinder 1 1.000 - - FOG0001571
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100483
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.