DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-A and spn-D

DIOPT Version :9

Sequence 1:NP_524583.1 Gene:spn-A / 43577 FlyBaseID:FBgn0003479 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_733200.1 Gene:spn-D / 318579 FlyBaseID:FBgn0003482 Length:270 Species:Drosophila melanogaster


Alignment Length:243 Identity:69/243 - (28%)
Similarity:104/243 - (42%) Gaps:37/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 QLSTGSKELDKLLGGGIETGSITEIFGEFRCGKTQLCHTLAVTCQLPISQKGGEGKCMYIDTENT 162
            ::.||.|.||...||||..|.:.|:.|....||||:|..|.:..|:|.:..|.||..::|||...
  Fly    45 KILTGKKALDTHFGGGISLGHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGSALFIDTRQD 109

  Fly   163 FRPERLAAIAQRYKLNESEVLDNVAFTRAHNSDQQ------TKLIQMAAGMLFESRY-------A 214
            |.|:||..:|.:.   |.:....|...:||...|:      .||.|:.|.:|...|:       .
  Fly   110 FHPDRLMGLALKL---ERQYAHRVPEFKAHKMLQKIHYVRCPKLDQLMATVLSCHRHLVDHPDIK 171

  Fly   215 LLIVDSAMALYR--SDYIGRGELAARQNHLGLFLRMLQRLADEFGVAVVITNQVT-----ASLDG 272
            |:::||.....|  .|...|.|:..   .|...:|.|||   :..:..|.||.:|     .....
  Fly   172 LIVIDSLAFTLRMLEDGAHRYEMLL---ELHESMRRLQR---QHELTWVFTNVLTHRYVKQKFQV 230

  Fly   273 APGMFDAKKPIGGHIMAHSSTTRLYLRKGKGETRICKIYDSPCLPESE 320
            .|.:.|....:....:..|.::.|:|.|....:|:.|        |||
  Fly   231 EPALGDLHSHLINERIWFSGSSELHLGKSWRTSRLIK--------ESE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-ANP_524583.1 recomb_RAD51 22..335 CDD:274048 69/243 (28%)
HHH_5 30..77 CDD:291205
Rad51_DMC1_radA 99..331 CDD:238543 69/242 (29%)
spn-DNP_733200.1 P-loop_NTPase 46..249 CDD:304359 60/211 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445393
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22942
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.