DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-A and Rad51d

DIOPT Version :9

Sequence 1:NP_524583.1 Gene:spn-A / 43577 FlyBaseID:FBgn0003479 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001100499.1 Gene:Rad51d / 303375 RGDID:1306944 Length:329 Species:Rattus norvegicus


Alignment Length:311 Identity:81/311 - (26%)
Similarity:130/311 - (41%) Gaps:42/311 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ITAKDIKLLQQASLHTVESVANATKKQLMAIPGLGGG---KVEQIITEANKLVPLGFLSARTFYQ 91
            :|.:.::||:...:.||..:|.|..:::....||...   .:.:::.......||.  .|..:.:
  Rat    12 LTEEIVQLLRGRKIKTVADLAAADLEEVAQKCGLSYKALVALRRVLLAQFSAFPLN--GADLYEE 74

  Fly    92 MRADVVQLSTGSKELDKLLGGGIETGSITEIFGEFRCGKTQLCHTLAVTCQLPISQKGGEGKCMY 156
            ::.....||||...|||||..|:.||.:|||.|....||||:|..:|......:.|     ..:|
  Rat    75 LKTSTAILSTGIGSLDKLLDAGLYTGELTEIVGGPGSGKTQVCLCVAANVAHSLQQ-----NVLY 134

  Fly   157 IDTENTFRPERLAAIAQRYKLNE---SEVLDNVAFTRAHNSDQQTKLIQMAAGMLFESRYA---- 214
            :|:.......||..:.|....:|   :..|..:....:.:..|...::|...|.:.:...|    
  Rat   135 VDSNGGMTASRLLQLLQARTQDEEKQASALQRIQVVHSFDIFQMLDMLQDLRGTMAQQATASSGT 199

  Fly   215 --LLIVDSAMALYRSDYIGRGELAARQNHLGLFLRM-----LQRLADEFGVAVVITNQVTASLDG 272
              ::||||..|:.       ..|...|...||.|.|     |:.||.:.|||||:||.:|...|.
  Rat   200 VKVVIVDSVTAVV-------APLLGGQQREGLALMMQLARELKILARDLGVAVVVTNHLTRDRDS 257

  Fly   273 APGMFDAKKPIGGHIMAHSSTTRLYLR--KGKG----ETRICKIYDSPCLP 317
            .     ..||..|...:...:||:.|.  :|.|    ..|..::..||..|
  Rat   258 R-----RFKPALGRSWSFVPSTRILLEVFEGAGTLGRSQRTVRLIKSPRQP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-ANP_524583.1 recomb_RAD51 22..335 CDD:274048 81/311 (26%)
HHH_5 30..77 CDD:291205 9/49 (18%)
Rad51_DMC1_radA 99..331 CDD:238543 69/239 (29%)
Rad51dNP_001100499.1 recomb_radA 10..305 CDD:131290 81/311 (26%)
Rad51_DMC1_radA 82..318 CDD:238543 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.