DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spn-A and Rad51c

DIOPT Version :9

Sequence 1:NP_524583.1 Gene:spn-A / 43577 FlyBaseID:FBgn0003479 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_036012127.1 Gene:Rad51c / 114714 MGIID:2150020 Length:409 Species:Mus musculus


Alignment Length:301 Identity:72/301 - (23%)
Similarity:119/301 - (39%) Gaps:86/301 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AKDIKLLQQASLHTVE----------------SVAN--ATKKQLMAIPGLGGGKVEQIITEANKL 78
            :|::.:.::.:|.|::                ||||  .|..:|:          ||..|:    
Mouse   153 SKEVGISKEEALETLQILRRECLTNKPRCAGTSVANEKCTALELL----------EQEHTQ---- 203

  Fly    79 VPLGFLSARTFYQMRADVVQLSTGSKELDKLLGGGIETGSITEIFGEFRCGKTQLCHTLAVTCQL 143
               ||               :.|....||.:|||||.....||:.|....||||||..|||..|:
Mouse   204 ---GF---------------IITFCSALDNILGGGIPLMKTTEVCGVPGVGKTQLCMQLAVDVQI 250

  Fly   144 PISQKGGEGKCMYIDTENTFRPERLAAIA----QRYKL-----NESE------------VLDNVA 187
            |....|..|:.::||||.:|..:|:.::|    |...|     .|.|            :|.::.
Mouse   251 PECFGGVAGEAVFIDTEGSFMVDRVVSLATACIQHLHLIAGTHTEEEHQKALKDFTLENILSHIY 315

  Fly   188 FTRAHNSDQQTKLIQMAAGMLFE-SRYALLIVDSAMALYRSDYIGRGELAARQNHLGLFLRMLQR 251
            :.|.|:..:....:.:....|.: .:..|:|:|.....:|.|.   .:|:.|...|....:.:..
Mouse   316 YFRCHDYTELLAQVYLLPDFLSDHPKVQLVIIDGIAFPFRHDL---EDLSLRTRLLNGLAQQMIS 377

  Fly   252 LADEFGVAVVITNQVTASLDGAPGMFDAKKPIGGHIMAHSS 292
            ||:...:|:....|||.    ..|::|.       |..|:|
Mouse   378 LANNHRLAICNIVQVTK----PEGVYDT-------ISDHTS 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spn-ANP_524583.1 recomb_RAD51 22..335 CDD:274048 72/301 (24%)
HHH_5 30..77 CDD:291205 12/62 (19%)
Rad51_DMC1_radA 99..331 CDD:238543 58/216 (27%)
Rad51cXP_036012127.1 radA 127..409 CDD:235273 72/301 (24%)
Rad51C 224..>393 CDD:410900 43/171 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0468
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.