DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jasper and AT3G63070

DIOPT Version :10

Sequence 1:NP_651768.1 Gene:Jasper / 43576 FlyBaseID:FBgn0039743 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_191866.3 Gene:AT3G63070 / 825482 AraportID:AT3G63070 Length:1347 Species:Arabidopsis thaliana


Alignment Length:132 Identity:39/132 - (29%)
Similarity:65/132 - (49%) Gaps:19/132 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKEKAAAS----YSIGDLVFAKVKGYPPWPAKITK------SNNNKKYNVYFYGTGETANIKLED 56
            |:..||:|    :.:||||.|||||:|.|||.:.:      |.::||..|:|:||.:.|.....|
plant    10 GRAAAASSARREWKVGDLVLAKVKGFPAWPAVVDEPEKWGHSADSKKVTVHFFGTQQIAFCNHGD 74

  Fly    57 LFPYASNKER-FATEKIMKRAKFIEAIDQIESA---LRGEDSAPIDLLDGAEPVAPPTTGDGVKT 117
            :..:...|:: ..|.:..|.:.|:.|:.:|..:   |:.:|.|     .|.:.....|.|....|
plant    75 VESFTEEKKQSLLTRRHAKGSDFVRAVKEITESYEKLKQQDQA-----SGPKYAEETTAGSSGNT 134

  Fly   118 EE 119
            .:
plant   135 SQ 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JasperNP_651768.1 PWWP_HRP 10..86 CDD:438959 27/82 (33%)
LEDGF 320..440 CDD:463284
AT3G63070NP_191866.3 PWWP_HULK 25..114 CDD:438975 29/88 (33%)
VHS_ENTH_ANTH 852..983 CDD:470608
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.