DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15528 and AT4G18593

DIOPT Version :10

Sequence 1:NP_651767.2 Gene:CG15528 / 43575 FlyBaseID:FBgn0039742 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_567561.1 Gene:AT4G18593 / 827592 AraportID:AT4G18593 Length:142 Species:Arabidopsis thaliana


Alignment Length:86 Identity:20/86 - (23%)
Similarity:33/86 - (38%) Gaps:14/86 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FANETVEKESRQNQLSASTLEDHTPFPGLSRITPSLI----LCGAAAVVPAYMDKLGVSCV---- 72
            ||.:.....|.|.|.|:..:|   |...:..|...::    ||........|.:..|:.|.    
plant    54 FAWKKRSGNSEQVQCSSIFVE---PMKWMQTIHDGMVEEKLLCFGCNGRLGYFNWAGMQCSCGAW 115

  Fly    73 INVAPELPDTPL---PSQKNP 90
            :|.|.:|..:.:   .|:.||
plant   116 VNPAFQLNKSRIDECKSEPNP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15528NP_651767.2 DUSP14-like 44..179 CDD:350364 12/58 (21%)
AT4G18593NP_567561.1 None

Return to query results.
Submit another query.