DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15528 and MKP1

DIOPT Version :10

Sequence 1:NP_651767.2 Gene:CG15528 / 43575 FlyBaseID:FBgn0039742 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_567018.5 Gene:MKP1 / 824693 AraportID:AT3G55270 Length:784 Species:Arabidopsis thaliana


Alignment Length:116 Identity:36/116 - (31%)
Similarity:58/116 - (50%) Gaps:6/116 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VSCVINVAPELPDTPLPSQKNPLYLRIMAQDRSEVDLAKHFDEAADLIEEVHLSGGCTLIHCVAG 133
            ::|| .:.||.      .:.:..|..:..||....|:.....:..|..|:|....|...:||..|
plant   180 LNCVXFICPEY------FKSDFCYRSLWLQDSPSEDITSILYDVFDYFEDVREQSGRIFVHCCQG 238

  Fly   134 VSRSASLCLAYLMKHAGMSLREAYKHVQAIRPQVRPNSGFFQQLRRYEQQL 184
            ||||.||.:||||...|.|..:|:::|::.|....||.||..||.:.::::
plant   239 VSRSTSLVIAYLMWREGQSFDDAFQYVKSARGIADPNMGFACQLLQCQKRV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15528NP_651767.2 DUSP14-like 44..179 CDD:350364 36/109 (33%)
MKP1NP_567018.5 DSP 150..284 CDD:350348 36/109 (33%)
ADF_gelsolin <323..392 CDD:472830
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.