DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15528 and Dusp12

DIOPT Version :10

Sequence 1:NP_651767.2 Gene:CG15528 / 43575 FlyBaseID:FBgn0039742 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_071584.1 Gene:Dusp12 / 64014 RGDID:68375 Length:339 Species:Rattus norvegicus


Alignment Length:165 Identity:56/165 - (33%)
Similarity:89/165 - (53%) Gaps:7/165 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ITPSLILCGAAAVV-PAYMDKLGVSCVINVAPELPDTPLPSQKNPLY-LRIMAQDRSEVDLAKHF 109
            :.|.|.|.|||||. |.|:.:.|::.|:.|..| |..|..:....|. |.:.|.|:.|.||..|.
  Rat    30 VRPGLYLGGAAAVAGPDYLREAGITAVLTVDSE-PAFPAGAGFEGLQSLFVPALDKPETDLLSHL 93

  Fly   110 DEAADLIEEVHLSGGCTLIHCVAGVSRSASLCLAYLMKHAGMSLREAYKHVQAIRPQVRPNSGFF 174
            |.....|.:....|...|:||.||||||.::..|::||...::..:||:::|.|:|:.:.|.||.
  Rat    94 DRCVAFIGQARSEGRAVLVHCHAGVSRSVAVVTAFIMKTEQLTFEKAYENLQTIKPEAKMNEGFE 158

  Fly   175 QQLRRYE---QQLRGSSSVAMVY-FASLDKEIPDI 205
            .||:.||   .::..||:|...| ...:.::.|::
  Rat   159 WQLKLYEAMGHEVHTSSAVYKQYRLQKVTEKYPEL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15528NP_651767.2 DUSP14-like 44..179 CDD:350364 49/133 (37%)
Dusp12NP_071584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
DSP_DUSP12 28..172 CDD:350370 51/142 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.