DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15528 and ssh2b

DIOPT Version :10

Sequence 1:NP_651767.2 Gene:CG15528 / 43575 FlyBaseID:FBgn0039742 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_009293925.1 Gene:ssh2b / 557912 ZFINID:ZDB-GENE-081205-4 Length:1179 Species:Danio rerio


Alignment Length:150 Identity:45/150 - (30%)
Similarity:72/150 - (48%) Gaps:4/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 MDKLGVSCVINVAPELPDTPLPSQKNPLYLRIMAQDRSEVDLAKHFDEAADLIEEVHLSGGCTLI 128
            :...||..::||..|: |...|....  |..|...|....||..::::....|.....:|...|:
Zfish   347 LQNTGVQYILNVTREI-DNFFPGLFE--YHNIRVYDEEATDLLAYWNDTYKFISRAKKAGAKCLV 408

  Fly   129 HCVAGVSRSASLCLAYLMKHAGMSLREAYKHVQAIRPQVRPNSGFFQQLRRYEQQLRGSSS-VAM 192
            ||..|||||||..:||.||..|..:.:|:::|:..|...:||..|.:||..|:..|..|.. ...
Zfish   409 HCKMGVSRSASTVIAYAMKEYGWDMEQAFEYVKERRAVTKPNPSFMRQLVEYQGILIASKQRHNK 473

  Fly   193 VYFASLDKEIPDILEPEYRA 212
            ::.:..|.::.:.|||..:|
Zfish   474 LWRSHSDSDLSERLEPLCKA 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15528NP_651767.2 DUSP14-like 44..179 CDD:350364 37/114 (32%)
ssh2bXP_009293925.1 SSH-N 38..254 CDD:212166
DEK_C 262..320 CDD:462592
DSP_slingshot_2 323..466 CDD:350417 39/121 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.