DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15528 and puc

DIOPT Version :9

Sequence 1:NP_651767.2 Gene:CG15528 / 43575 FlyBaseID:FBgn0039742 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster


Alignment Length:195 Identity:67/195 - (34%)
Similarity:97/195 - (49%) Gaps:30/195 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KESRQNQLS---ASTLEDHTPFPGLSRITPSLI-LCGAAAVV--------PAY------------ 63
            |.||:|...   .||....|...|..| ||:|. .|.:.||.        |.:            
  Fly    87 KRSRENLACDEVTSTTSSSTAMNGGGR-TPALTRSCSSPAVYDIETHPASPVFPHLLLGNGRDAD 150

  Fly    64 -MDKLGVSCVINVAPELP-DTPLPSQKNPLYLRIMAQDRSEVDLAKHFDEAADLIEEVHLSGGCT 126
             ...:|.:||:||..:.| ::.|...|   |::|.|.|....::.::|.||.|.||:...:|...
  Fly   151 DPSSVGANCVLNVTCQSPNESHLQGLK---YMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRV 212

  Fly   127 LIHCVAGVSRSASLCLAYLMKHAGMSLREAYKHVQAIRPQVRPNSGFFQQLRRYEQQLRGSSSVA 191
            |:||.||:||||::.:||:|::..:||.||||.|:..||.:.||..|..||...||.||.|..:|
  Fly   213 LLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLA 277

  Fly   192  191
              Fly   278  277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15528NP_651767.2 DSPc 43..181 CDD:238073 54/160 (34%)
pucNP_524273.1 DSPc 133..267 CDD:238073 46/136 (34%)
CDC14 <193..272 CDD:225297 36/78 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462492
Domainoid 1 1.000 44 1.000 Domainoid score I728
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9172
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.