DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15528 and Mkp3

DIOPT Version :10

Sequence 1:NP_651767.2 Gene:CG15528 / 43575 FlyBaseID:FBgn0039742 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster


Alignment Length:141 Identity:56/141 - (39%)
Similarity:77/141 - (54%) Gaps:3/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ITPSLILCGAA--AVVPAYMDKLGVSCVINVAPELPDTPLPSQKNPLYLRIMAQDRSEVDLAKHF 109
            |.|.|:..|.|  :.....:.|..:..|:||.|:||: ......:..||:|...|....|||.||
  Fly   218 IIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPN-KFKESGDIKYLQIPITDHYSQDLAIHF 281

  Fly   110 DEAADLIEEVHLSGGCTLIHCVAGVSRSASLCLAYLMKHAGMSLREAYKHVQAIRPQVRPNSGFF 174
            .:|...|||...:....|:||:||||||.::.|||||...|:||.:|:..|:..:|.|.||..|.
  Fly   282 PDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFHFM 346

  Fly   175 QQLRRYEQQLR 185
            |||..:|.|||
  Fly   347 QQLLSFESQLR 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15528NP_651767.2 DUSP14-like 44..179 CDD:350364 52/133 (39%)
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 52/134 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.