DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15528 and Ssh3

DIOPT Version :10

Sequence 1:NP_651767.2 Gene:CG15528 / 43575 FlyBaseID:FBgn0039742 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_038941428.1 Gene:Ssh3 / 365396 RGDID:1308679 Length:681 Species:Rattus norvegicus


Alignment Length:146 Identity:56/146 - (38%)
Similarity:75/146 - (51%) Gaps:8/146 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SRITPSLILCGAAAVVPAYMDKL---GVSCVINVAPELPDTPLPSQKNPLYLRIMAQDRSEVDLA 106
            |||.|.|.|  .:....|.:::|   .||.::|:|.|: |...|.:..  |..:...|.....|.
  Rat   356 SRIFPHLYL--GSEWNAANLEELQRNRVSHILNMAREI-DNFFPERFT--YHNVRVWDEESAQLL 415

  Fly   107 KHFDEAADLIEEVHLSGGCTLIHCVAGVSRSASLCLAYLMKHAGMSLREAYKHVQAIRPQVRPNS 171
            .|:.|....||:....|...|:||..||||||:..|||.||..|..|.:|..|||.:||.||||.
  Rat   416 PHWKETHRFIEDARAQGTRVLVHCKMGVSRSAATVLAYAMKQYGWGLEQALIHVQELRPIVRPNP 480

  Fly   172 GFFQQLRRYEQQLRGS 187
            ||.:||:.|:..|..|
  Rat   481 GFLRQLQTYQGILTAS 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15528NP_651767.2 DUSP14-like 44..179 CDD:350364 53/136 (39%)
Ssh3XP_038941428.1 SSH-N 32..279 CDD:212166
DEK_C 298..349 CDD:462592
DSP_slingshot_3 352..495 CDD:350419 55/143 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.