DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15528 and Dusp5

DIOPT Version :10

Sequence 1:NP_651767.2 Gene:CG15528 / 43575 FlyBaseID:FBgn0039742 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001078859.1 Gene:Dusp5 / 240672 MGIID:2685183 Length:384 Species:Mus musculus


Alignment Length:198 Identity:64/198 - (32%)
Similarity:95/198 - (47%) Gaps:31/198 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GLSRITPSLILCGAA--AVVPAYMDKLGVSCVINVA---PELPDTPLPSQKNPLYLRIMAQDRSE 102
            |...|.|.|.| |:|  |....::..|.::.::||:   .|...|.|.      |..|..:|...
Mouse   178 GPVEILPFLYL-GSAYHASKCEFLANLHITALLNVSRRTSEACTTHLH------YKWIPVEDSHT 235

  Fly   103 VDLAKHFDEAADLIEEVHLSGGCTLIHCVAGVSRSASLCLAYLMKHAGMSLREAYKHVQAIRPQV 167
            .|::.||.||.|.|:.|...||..|:||.||||||.::|:|||||.....|:||:.:|:..|..|
Mouse   236 ADISSHFQEAIDFIDCVREEGGKVLVHCEAGVSRSPTICMAYLMKTKQFRLKEAFDYVKQRRSVV 300

  Fly   168 RPNSGFFQQLRRYEQQLRGSS-----------SVAMVYFASLDKEIPDILEPEYRAMEDFYQRYR 221
            .||.||..||.:||.::..|:           :.:..:...|....||        |:..|..:|
Mouse   301 SPNFGFMGQLLQYESEILPSTPTLQPPSCQGEAASSTFIGHLQTLSPD--------MQGTYCTFR 357

  Fly   222 SSL 224
            :|:
Mouse   358 TSV 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15528NP_651767.2 DUSP14-like 44..179 CDD:350364 53/139 (38%)
Dusp5NP_001078859.1 DSP_MapKP 5..140 CDD:238723
DSP_DUSP5 179..316 CDD:350487 55/143 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.