DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15528 and DUSP5

DIOPT Version :10

Sequence 1:NP_651767.2 Gene:CG15528 / 43575 FlyBaseID:FBgn0039742 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_004410.3 Gene:DUSP5 / 1847 HGNCID:3071 Length:384 Species:Homo sapiens


Alignment Length:184 Identity:60/184 - (32%)
Similarity:91/184 - (49%) Gaps:17/184 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PFANETVEKESRQNQLSASTLEDHTPFP-----GLSRITPSLILCGAA--AVVPAYMDKLGVSCV 72
            |.:.|.:|.|..........:.:.:..|     |...|.|.|.| |:|  |....::..|.::.:
Human   145 PISQEKIESERALISQCGKPVVNVSYRPAYDQGGPVEILPFLYL-GSAYHASKCEFLANLHITAL 208

  Fly    73 INVA---PELPDTPLPSQKNPLYLRIMAQDRSEVDLAKHFDEAADLIEEVHLSGGCTLIHCVAGV 134
            :||:   .|...|.|.      |..|..:|....|::.||.||.|.|:.|...||..|:||.||:
Human   209 LNVSRRTSEACATHLH------YKWIPVEDSHTADISSHFQEAIDFIDCVREKGGKVLVHCEAGI 267

  Fly   135 SRSASLCLAYLMKHAGMSLREAYKHVQAIRPQVRPNSGFFQQLRRYEQQLRGSS 188
            |||.::|:|||||.....|:||:.:::..|..|.||.||..||.:||.::..|:
Human   268 SRSPTICMAYLMKTKQFRLKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPST 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15528NP_651767.2 DUSP14-like 44..179 CDD:350364 51/139 (37%)
DUSP5NP_004410.3 DSP_MapKP 5..140 CDD:238723
Nuclear localization signal. /evidence=ECO:0000255 53..74
DSP_DUSP5 179..316 CDD:350487 53/143 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.