DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15528 and DUSP10

DIOPT Version :10

Sequence 1:NP_651767.2 Gene:CG15528 / 43575 FlyBaseID:FBgn0039742 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_009138.1 Gene:DUSP10 / 11221 HGNCID:3065 Length:482 Species:Homo sapiens


Alignment Length:153 Identity:59/153 - (38%)
Similarity:83/153 - (54%) Gaps:18/153 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 MDKLGVSCVINVAPELPDTPLPSQKNPL--YLRIMAQDRSEVDLAKHFDEAADLIEEVHLSGGCT 126
            |.:|.:..||||...|   ||...:..|  |.|:.|.|.::.:|.::|:||.:.|||.|..|...
Human   343 MQRLNIGYVINVTTHL---PLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGL 404

  Fly   127 LIHCVAGVSRSASLCLAYLMKHAGMSLREAYKHVQAIRPQVRPNSGFFQQLRRYEQQLRGSSSVA 191
            ||||.|||||||::.:||||||..|::.:|||.|:..||.:.||..|..||..:|:.|....:  
Human   405 LIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVT-- 467

  Fly   192 MVYFASLDKEIPDILEPEYRAME 214
                       |.||.|:...:|
Human   468 -----------PRILTPKLMGVE 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15528NP_651767.2 DUSP14-like 44..179 CDD:350364 52/116 (45%)
DUSP10NP_009138.1 DSP_MapKP 149..284 CDD:238723
Interaction with MAP kinases 199..215
DSP_DUSP10 322..473 CDD:350415 57/145 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.