DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and SLC25A51

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_219480.1 Gene:SLC25A51 / 92014 HGNCID:23323 Length:297 Species:Homo sapiens


Alignment Length:305 Identity:126/305 - (41%)
Similarity:181/305 - (59%) Gaps:18/305 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PPKRFPSGRAHSPHGDGEAGKLLHGSVFSKRFFGSFQWEEFACGCGAAFVNIAVTYPIYKMIFRQ 81
            ||....|.:..||| ....|::.|                :.|||.|||.|:|:|:||.|::|||
Human    11 PPILTSSKQDISPH-ITNVGEMKH----------------YLCGCCAAFNNVAITFPIQKVLFRQ 58

  Fly    82 MLHGVPITSAFAQLRHEGLGFLYRGMLPPLAQKTISLSIMFGVFDGTRRYLVEDYRLNDYGAKVL 146
            .|:|:....|..|||.:|...||||:||||.|||.:|::|||:::.....|.:.....::....:
Human    59 QLYGIKTRDAILQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLHKHVSAPEFATSGV 123

  Fly   147 AAVVAGSAESILLPFERVQTLLADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSN 211
            |||:||:.|:|..|.|||||||.|.|.|..|:||..||: .:..||..|.||||.|:.:||||||
Human   124 AAVLAGTTEAIFTPLERVQTLLQDHKHHDKFTNTYQAFK-ALKCHGIGEYYRGLVPILFRNGLSN 187

  Fly   212 ALFFVLREEASVRLPKRKSVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSLQSEMGQRSEGSWQ 276
            .|||.||......||...:.|...|.:||.|.::||.:..:|:|:||:|..:||::|...:...:
Human   188 VLFFGLRGPIKEHLPTATTHSAHLVNDFICGGLLGAMLGFLFFPINVVKTRIQSQIGGEFQSFPK 252

  Fly   277 ACKRIYVERDRRIGNFYRGCPFNTGRSFISWGIMNTAYENLKKLM 321
            ..::|::||||::.|.:||...|..||.|||||:|..||.|.|::
Human   253 VFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKVI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 38/81 (47%)
Mito_carr 141..229 CDD:278578 44/87 (51%)
Mito_carr 235..322 CDD:278578 35/87 (40%)
SLC25A51NP_219480.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 3/8 (38%)
Solcar 1. /evidence=ECO:0000255 28..108 39/95 (41%)
Mito_carr 31..112 CDD:395101 39/96 (41%)
Solcar 2. /evidence=ECO:0000255 116..200 42/84 (50%)
Mito_carr 210..297 CDD:395101 35/86 (41%)
Solcar 3. /evidence=ECO:0000255 213..296 33/82 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7940
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H88487
Inparanoid 1 1.050 238 1.000 Inparanoid score I3370
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59392
OrthoDB 1 1.010 - - D503015at33208
OrthoFinder 1 1.000 - - FOG0004171
OrthoInspector 1 1.000 - - otm41713
orthoMCL 1 0.900 - - OOG6_107186
Panther 1 1.100 - - LDO PTHR46131
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3422
SonicParanoid 1 1.000 - - X4548
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1313.010

Return to query results.
Submit another query.