DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and Slc25a53

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_011246060.2 Gene:Slc25a53 / 67062 MGIID:1914312 Length:352 Species:Mus musculus


Alignment Length:306 Identity:99/306 - (32%)
Similarity:157/306 - (51%) Gaps:32/306 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DGEAGKLLHGSVFSKRFFGSFQWEEFACGCGAA--FVNIAVTYPIYKMIFRQMLHGVPITSAFAQ 94
            |..|||.|.....::. .|:..|:..|...||.  |::..:|:||||::|||.:|.|.::.|..|
Mouse    51 DNTAGKKLQHQTRAEA-PGTKSWQSQAYTLGAISNFMSTFLTFPIYKVVFRQQIHAVALSEAVKQ 114

  Fly    95 LRHEGLGFLYRGMLPPLAQKTISLSIMFGVFDGTRRYL--VEDYRLNDYGAKVLAAVVAGSAESI 157
            |.|||..:.|||:.|||..||:..:::||.:|....:|  |..:.|   |.:..|.:::|..|::
Mouse   115 LWHEGPQYFYRGIYPPLLSKTLQGTLLFGTYDSLLCFLSPVGPHSL---GQRWTAGLMSGVVEAV 176

  Fly   158 LL-PFERVQTLLADSKFHQHFSNTQNAFRYVVSHH-------GYRELYRGLEPVFWRNGLSNALF 214
            .| ||||||.:|.|::....|.:|.:..:...|:.       ||   |||..||..||.|.:||:
Mouse   177 ALSPFERVQNVLQDARKQACFPSTFSILKEFNSYGLWGRLSLGY---YRGFWPVLVRNSLGSALY 238

  Fly   215 FVLREE-----ASVRLPKRKSVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSLQSEMG-QRSEG 273
            |..::.     |...||       ..|...::|:|.|.....|.|||.|:..::||.:| ||...
Mouse   239 FSFKDPIQDGLARQGLP-------HWVPALVSGSVNGTITCLILYPLMVLVANMQSHIGWQRMPS 296

  Fly   274 SWQACKRIYVERDRRIGNFYRGCPFNTGRSFISWGIMNTAYENLKK 319
            .|.:.:.::..|.|:|...|||......||.::||:....::.|::
Mouse   297 LWASAQDVWDTRGRKILLIYRGGSLIVLRSSVTWGLTTAIHDFLQR 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 34/85 (40%)
Mito_carr 141..229 CDD:278578 32/100 (32%)
Mito_carr 235..322 CDD:278578 26/86 (30%)
Slc25a53XP_011246060.2 Mito_carr 80..148 CDD:395101 30/67 (45%)
Mito_carr 156..249 CDD:395101 30/98 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1519
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D503015at33208
OrthoFinder 1 1.000 - - FOG0004171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46131
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.