DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and aralar1

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster


Alignment Length:295 Identity:78/295 - (26%)
Similarity:116/295 - (39%) Gaps:52/295 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 FACGCGAAFVNIAVTYPI--YKMIFRQMLHGVPITSAFAQ---------LRHEGLGFLYRGMLPP 110
            |..|..|..|...|.|||  .|...:....|..|.....:         :||||...||||:||.
  Fly   358 FTLGSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQ 422

  Fly   111 L----AQKTISLSIMFGVFDGTRRYLVEDYRLNDYG-----AKVLAAVVAGSAESILL-PFERVQ 165
            |    .:|.|.|::         ..||.|...:..|     |:|||...||:::.:.. |.|.|:
  Fly   423 LMGVAPEKAIKLTV---------NDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVK 478

  Fly   166 TLL-------ADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSNALFFVLREEASV 223
            ..|       :.||....         .||...|...||:|......|:...:|::|........
  Fly   479 IRLQVAGEIASGSKIRAW---------SVVRELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKA 534

  Fly   224 RLPKRKSVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSLQ--SEMGQRS-EGSWQACKRIYVER 285
            .:..:...: ..:....|||:.|...:::..|.:|||..||  :..||.: .|.|.|.|:|..|.
  Fly   535 MMADKDGYN-HPLTLLAAGAIAGVPAASLVTPADVIKTRLQVVARSGQTTYTGVWDATKKIMAEE 598

  Fly   286 DRRIGNFYRGCPFNTGRSFISWGIMNTAYENLKKL 320
            ..|.  |::|......||...:|:....||.|::|
  Fly   599 GPRA--FWKGTAARVFRSSPQFGVTLVTYELLQRL 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 27/93 (29%)
Mito_carr 141..229 CDD:278578 22/100 (22%)
Mito_carr 235..322 CDD:278578 28/89 (31%)
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 28/98 (29%)
PTZ00169 358..631 CDD:240302 77/293 (26%)
Mito_carr 449..539 CDD:278578 22/98 (22%)
Mito_carr 544..633 CDD:278578 28/90 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441995
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.