DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and CG1907

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:178 Identity:39/178 - (21%)
Similarity:74/178 - (41%) Gaps:20/178 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 ACGCGAAFVNIAVTYPIYKMI------FRQMLHGVPITSAFAQL-RHEGLGFLYRGMLPPLAQKT 115
            |||   ||:.......:.:|.      ..:..:...:.:|.|:: |.|||..|:||.||.:.:..
  Fly   127 ACG---AFIGTPAEVALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAM 188

  Fly   116 ISLSIMFGVFDGTRRYLVEDYRLNDYGAKV--LAAVVAGSAESIL-LPFE----RVQTL-LADSK 172
            :........:...:.|........:.|.|:  .|::::|...:|. :|.:    |:|.: :.|.|
  Fly   189 VVNMTQLASYSQFKTYFRH
GPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGK 253

  Fly   173 FHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSNALFFVLREE 220
              ..:..|.:....|....|...|::|..|.:.|.|....|.|::.|:
  Fly   254 --PEYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQ 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 18/84 (21%)
Mito_carr 141..229 CDD:278578 21/88 (24%)
Mito_carr 235..322 CDD:278578
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578
Mito_carr 118..207 CDD:278578 18/82 (22%)
Mito_carr 219..307 CDD:278578 19/83 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442027
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.