DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and CG5805

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:357 Identity:74/357 - (20%)
Similarity:131/357 - (36%) Gaps:104/357 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AHSPHGDGEAG------KLLHGSVFSK-RFFGSFQWEEFACGCGAAFVNIAVTY-------PIYK 76
            |.:|.|.|.|.      :.:...:.:| :||.......|:..|....:.:..|.       .:||
  Fly    13 AVAPTGVGGAAEGATYIRTIEWDMMNKTKFFPLSMLSSFSVRCCLFPLTVIKTQLQVQHKSDVYK 77

  Fly    77 MIFRQMLHGVPITSAFAQLRHEGLGFLYRGMLPPLAQKTISLSIMFGVF-----DGTRRYLVEDY 136
            .:         :..|....|.||:..||||..      ..|:.|:.|||     :|.|      :
  Fly    78 GM---------VDCAMKIYRSEGVPGLYRGFW------ISSVQIVSGVFYISTYEGVR------H 121

  Fly   137 RLNDYGAKVLAAVVAGS------AESILLPFERV--------QTLLADSK--------------F 173
            .|||.||......:||.      .::|::||:.:        .:..|.||              .
  Fly   122 VLNDLGAGHRMKALAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINPLGIKSWPGRS 186

  Fly   174 HQHFSNTQNAFRYVVSHHGYRELYRGL----------EPVFWRNGLSNALFFVLREEASVRLPKR 228
            ..|.|  .:..|.::...|:|..|||.          ..::|      |.:.:.::|.....|  
  Fly   187 RLHIS--MDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWW------AFYHLYQDELFRICP-- 241

  Fly   229 KSVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSLQ----SEMGQRSEGSWQACKRIYVERDRRI 289
            ..||...:| .:||::.|.:.:.:..||::::..||    ..|.......||         :.::
  Fly   242 VWVSHLFIQ-CVAGSLGGFTTTILTNPLDIVRARLQVHRLDSMSVAFRELWQ---------EEKL 296

  Fly   290 GNFYRGCPFNTGRS-FISWGIMNTAYENLKKL 320
            ..|::|......:| ..|:.|: ..||.:|::
  Fly   297 NCFFKGLSARLVQSAAFSFSII-LGYETIKRI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 20/93 (22%)
Mito_carr 141..229 CDD:278578 22/125 (18%)
Mito_carr 235..322 CDD:278578 19/91 (21%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 21/99 (21%)
Mito_carr 132..238 CDD:395101 19/113 (17%)
Mito_carr 245..327 CDD:395101 20/92 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441541
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.