DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and DPCoAC

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:283 Identity:71/283 - (25%)
Similarity:120/283 - (42%) Gaps:34/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GCGAAFVNIAVTYPI--YKMIFRQMLHGVPITSAFAQLRH-------EGLGFLYRGMLPPLAQKT 115
            |..|..:...|..|:  .|:.| |:.:.||. |..|.||:       ||:..|:||....:|:..
  Fly    79 GAAAGALAKTVIAPLDRTKINF-QIRNDVPF-SFRASLRYLQNTYANEGVLALWRGNSATMARIV 141

  Fly   116 ISLSIMFGVFDGTRRYL-VEDYRLNDYGAKVLAAVVAG-SAESILLPFERVQTLLADSKFHQHFS 178
            ...:|.|...:..||.| |:....|..|.:.||..:|| :::|:..|.:..:..:|.:..:..:.
  Fly   142 PYAAIQFTAHEQWRRILH
VDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARMAVTDRYTGYR 206

  Fly   179 NTQNAFRYVVSHHGYRELYRGLEPVFWRN--------GLSNALFFVLREEASVRLPKRKSVSTRT 235
            ..:..|..:....|.|.|:||    :|..        |.|...:..|:.|....:...|   ..|
  Fly   207 TLRQVFTKIWVEEGPRTLFRG----YWATVLGVIPYAGTSFFTYETLKR
EYYEVVGNNK---PNT 264

  Fly   236 VQEFIAGAVIGASISTIFYPLNVIKVSLQSEM-----GQRSEGSWQACKRIYVERDRRIGNFYRG 295
            :.....||..||:..|..|||::::..:|:..     |.|.....:...:||.|...:.| ||:|
  Fly   265 LVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVKNG-FYKG 328

  Fly   296 CPFNTGRSFISWGIMNTAYENLK 318
            ...|..:..|:.||..:.|:.:|
  Fly   329 LSMNWIKGPIAVGISFSTYDLIK 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 25/85 (29%)
Mito_carr 141..229 CDD:278578 19/96 (20%)
Mito_carr 235..322 CDD:278578 25/89 (28%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 23/81 (28%)
Mito_carr 169..251 CDD:278578 18/85 (21%)
Mito_carr 279..356 CDD:278578 20/74 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442031
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.