DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and GC2

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:286 Identity:56/286 - (19%)
Similarity:104/286 - (36%) Gaps:52/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KLLHGSVFSKRFFGSFQWEEFACGCGAAFVNIAVTYPI--YKMIFRQMLHG-------VPITSAF 92
            |:::|.|                   |..:.:|..||:  .|...:....|       ..|...|
  Fly    23 KIINGGV-------------------AGIIGVACVYPLDMVKTRLQNQTIGPNGERMYTSIADCF 68

  Fly    93 AQ-LRHEGLGFLYRGMLPPLAQKTISLSIMFGVFDGTRRYLVEDYRLNDYGAKVLAAVVAGSAES 156
            .: :..||...:|||....:...|...:|.....|..|.:|..|..:.......||..:||..:.
  Fly    69 RKTIASEGYFGMYRGSAVNIVLITPEKAIKLTANDFFRYHLASDDGVIPLSRATLAGGLAGLFQI 133

  Fly   157 IL-LPFERVQTLLADS--------------KFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWR 206
            :: .|.|.::..:.|:              |.......|:...|    ..|...||:|:.....|
  Fly   134 VVTTPMELLKIQMQDAGRVAAADRAAGREVKTITALGLTKTLLR----ERGIFGLYKGVGATGVR 194

  Fly   207 NGLSNALFFVLREEASVRLPKRKSVSTRTV--QEFIAGAVIGASISTIFYPLNVIKVSLQSEMGQ 269
            :...:.::|.|....:.:.|::...|...|  ...|||.:.|.:.:.:..|.:|:|..||::..:
  Fly   195 DITFSMVYFPLMAWINDQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQADGEK 259

  Fly   270 RSEGSWQACKRIYVERDRRIGNFYRG 295
            :.:|......|..  ::..|..|::|
  Fly   260 KFKGIMDCVNRTL--KEEGISAFFKG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 18/91 (20%)
Mito_carr 141..229 CDD:278578 18/102 (18%)
Mito_carr 235..322 CDD:278578 15/63 (24%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 56/286 (20%)
Mito_carr 16..106 CDD:278578 19/101 (19%)
Mito_carr 123..203 CDD:278578 15/83 (18%)
Mito_carr 228..302 CDD:278578 14/58 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442030
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.