DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and GC1

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:202 Identity:44/202 - (21%)
Similarity:80/202 - (39%) Gaps:55/202 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 EGLGFLYRG------MLPPLAQKTISLSIMFGVFDGTRRYLVEDYRLNDY--------------G 142
            ||...:|||      ::.|  :|.|.|:                  .|||              .
  Fly    76 EGYFGMYRGSGVNILLITP--EKAIKLT------------------ANDYFRHKLTTK
DGKLPLT 120

  Fly   143 AKVLAAVVAGSAESIL-LPFERVQTLLADS-----------KFHQHFSNTQNAFRYVVSHHGYRE 195
            ::::|..:||:.:.|: .|.|.::..:.|:           |..:..|.||.|.: ::...|...
  Fly   121 SQMVAGGLAGAFQIIVTTPMELLKIQMQDAGRVAAAAKLAGKTVEKVSATQLASQ-LIKDKGIFG 184

  Fly   196 LYRGLEPVFWRNGLSNALFFVLREEASVRLPKRKSVSTRTV--QEFIAGAVIGASISTIFYPLNV 258
            ||:|:.....|:...:.::|.|....:...|:|...|...|  ..|:||...|::.:....|.:|
  Fly   185 LYKGIGATGLRDVTFSIIYFPLFATLNDL
GPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDV 249

  Fly   259 IKVSLQS 265
            :|..||:
  Fly   250 VKTRLQA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 9/43 (21%)
Mito_carr 141..229 CDD:278578 21/113 (19%)
Mito_carr 235..322 CDD:278578 10/33 (30%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 12/56 (21%)
Mito_carr 115..213 CDD:278578 19/98 (19%)
Mito_carr 226..307 CDD:278578 9/31 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442029
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.