DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and Tpc1

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster


Alignment Length:367 Identity:85/367 - (23%)
Similarity:138/367 - (37%) Gaps:93/367 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GAPNVAKTTDPPPPKRFPSGRAHSPHGDGEAGKLLHGSVFSKRFFGSFQWEEFACGCGAAFVNIA 69
            |:.:.|.||..|.|:|..|.|           :.||              :..|.|..|| :..:
  Fly     6 GSTSEATTTTTPVPRRKHSTR-----------EQLH--------------QMLAGGLSAA-ITRS 44

  Fly    70 VTYPIYKMIFRQMLHGVP------------ITSAFAQL--------RHEGLGFLYRGMLPPLAQK 114
            ...|:..:..|..|...|            :||.:..:        |.||:...::|..|  || 
  Fly    45 TCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFWKGHNP--AQ- 106

  Fly   115 TISLSIMFGV-----------FDGTRRYLVEDYRLNDYGAKVLAAVVAGSAESILLPFERVQTLL 168
              .||||:|:           ......||.:...|:::   :..|...|:|..|..|.:.::|.|
  Fly   107 --VLSIMYGICQFWTYEQLSLMAKQTSYLADHQHLSNF---LCGAAAGGAAVIISTPLDVIRTRL 166

  Fly   169 ADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLE-------PVFWRNGLSNALFFVLREE---ASV 223
            ......:.:.|...|...:|...|.|.:||||.       |:...|.::..||    .:   |.:
  Fly   167 IAQDTSKGYRNATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLF----SDWACAFL 227

  Fly   224 RLPKRKSVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSLQSE--------MGQ--RSEGSWQAC 278
            .:..|..:.|.|:...  ||..|....||.||.::||..||.:        .||  :..|.|. |
  Fly   228 EVSDRSQLPTWTLLGL--GASSGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQCHGVWD-C 289

  Fly   279 KRIYVERDRRIGNFYRGCPFNTGRSFISWGIMNTAYENLKKL 320
            .|:.| |...:...|:|......:|.::..:..:.|:.||::
  Fly   290 LRLTV-RQEGVRGLYKGVAPTLLKSSMTTALYFSIYDKLKQV 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 24/112 (21%)
Mito_carr 141..229 CDD:278578 21/97 (22%)
Mito_carr 235..322 CDD:278578 26/96 (27%)
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 24/113 (21%)
PTZ00169 33..329 CDD:240302 73/312 (23%)
Mito_carr 153..222 CDD:278578 17/72 (24%)
Mito_carr 233..328 CDD:278578 25/98 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.