DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and CG16736

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster


Alignment Length:237 Identity:43/237 - (18%)
Similarity:87/237 - (36%) Gaps:51/237 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IFRQML-HGVPITSAFAQLRHEGLGFLYRGMLPPLAQKTISLSIMFGVFDGTRRYLVEDYR---- 137
            :||.|. ||:|             ||.| |::....:.|:.....:.:|     |.::|.:    
  Fly    42 MFRLMARHGLP-------------GFYY-GIVAACLRCTVHTMSTYTLF-----YNLQDNKYVLM 87

  Fly   138 LNDYGAKVLAAVVAGSAESILLPFERVQTLLADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEP 202
            |..|...::..:.......:..||.::..:       :....|:.::    ....||..:|||:.
  Fly    88 LQPYNTSMVLGITGFWGGVLATPFAKLAVI-------RQADLTRGSY----ERRNYRNFWRGLKC 141

  Fly   203 VF-----------WR-NGLSNALFFVLREEASVRLPKRKSVSTRT----VQEFIAGAVIGASIST 251
            ::           |: |.:|:....||....|.::....|...|.    :.:.|..|:.|:.|:.
  Fly   142 MYAKGGFTYLFTGWKINSISSTAVAVLYTPISDKVHTVISWFHRLDEPWLSDLITMALTGSIITV 206

  Fly   252 IFYPLNVIKVSLQSEMGQRSEGSWQACKRIYVERDRRIGNFY 293
            |..|::.:.....:|.......|:....|..:.:....|.|:
  Fly   207 IMTPVDALATLTLNESSHYGRTSYPYLYRKIIRKHGYKGFFF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 13/58 (22%)
Mito_carr 141..229 CDD:278578 15/99 (15%)
Mito_carr 235..322 CDD:278578 11/63 (17%)
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 13/57 (23%)
Mito_carr 187..277 CDD:278578 11/62 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441892
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.