DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and Mpcp2

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster


Alignment Length:331 Identity:73/331 - (22%)
Similarity:122/331 - (36%) Gaps:92/331 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FGSFQWEEFA-CGCGAAFVNIAVTY-------------PIYKMIFRQMLHGVPITSAFAQLRHEG 99
            |||.::  || ||.| ..::...|:             .:.:..::.::||..:|.|     .||
  Fly    56 FGSTKY--FALCGIG-GILSCGTTHTFVVPLDLVKCRLQVDQAKYKNLVHGFKVTVA-----EEG 112

  Fly   100 LGFLYRGMLPPLAQKTISLSIMFGVFD-----------GTRRYLVEDYRLNDYGAKVLAAVVAGS 153
            ...|.:|..|.|...:......||:::           ....||   ||.:.|    |||..:..
  Fly   113 ARGLAKGWFPTLLGYSAQGLCKFGLYELFKVKYAEIIGEENAYL---YRTSLY----LAASASAE 170

  Fly   154 --AESILLPFE----RVQTLLADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSNA 212
              |:..|.|||    ::||:..      :.:|.:.|...::...|....|:||.|: |...:...
  Fly   171 FFADIALAPFEAAKVKIQTIPG------YANNFREAVPKMLKEEGVNAFYKGLVPL-WMRQIPYT 228

  Fly   213 LFFVLREEASVRL------PKRKSVSTRTVQ---EFIAGAVIGASISTIFYPLNVIKVSLQSEMG 268
            :......|.:|.|      ||.::..|:..|   .|.||.:.|...:.:.:|.:|:...|....|
  Fly   229 MMKFACFERTVELLYKYVVPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSKLNQAKG 293

  Fly   269 QRS---------EGSWQA-CKRIYVERDRRIGNFYRGCPFNTGRSFISWGIMNTAYENLK-KLMQ 322
            ..:         .|.|.. ..||.:     ||..          :.:.|.|    |:.:| .|..
  Fly   294 ASAISVAKSLGFSGMWNGLTPRIIM-----IGTL----------TALQWFI----YDGVKVALGI 339

  Fly   323 QQPPLP 328
            .:||.|
  Fly   340 PRPPPP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 20/106 (19%)
Mito_carr 141..229 CDD:278578 24/99 (24%)
Mito_carr 235..322 CDD:278578 20/100 (20%)
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 19/91 (21%)
Mito_carr <175..245 CDD:278578 17/76 (22%)
Mito_carr 260..338 CDD:278578 18/96 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441816
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.