DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and CG18418

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster


Alignment Length:298 Identity:65/298 - (21%)
Similarity:114/298 - (38%) Gaps:56/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EFACGCGAAFVNIAVTYPIYKMIFRQMLHGVPITSAFAQ--------LRHEGLGFLYRGMLPPLA 112
            :|..|..:..:...:..|:..:..|..:.|...|..:..        |::||:..||.|:...|.
  Fly    17 KFVMGGTSGMLATCIVQPLDLLKTRMQISGTLGTREYKNSFEVLSKVLKNEGILSLYNGLSAGLL 81

  Fly   113 QKTISLSIMFGVFDGTRRYLVE-DYRLNDYG------AKVLAAVVAGS--------AESILLPFE 162
            ::....|...||      |.:| |:...::|      |.:...:|||:        ||..|:...
  Fly    82 RQATYTSAKMGV------YQMELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPAEVALIRMM 140

  Fly   163 RVQTLLADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSNALFFVLREEASVRLPK 227
            ....|:.:.:  :::.|..:||..:|...|...|:||..|...|     |:...:.:.||..|.|
  Fly   141 SDNRLMPEDR--RNYKNVGDAFVRIVKDEGVVALWRGCLPTVGR-----AMVVNMVQLASYSLMK 198

  Fly   228 RK---SVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSLQS----EMGQRSEGSWQACKRIYVER 285
            .:   .:|........|..|.|...|....||::.|..:|.    :......|:....|::.   
  Fly   199 NQLHGYLSEGIPLHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSGTIDVLKKVL--- 260

  Fly   286 DRRIGNF--YRG-CPF------NTGRSFISWGIMNTAY 314
             :..|.|  ::| .|:      :|..||:....||.||
  Fly   261 -KNEGAFAVWKGFTPYLMRMGPHTIFSFVFLEQMNKAY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 18/88 (20%)
Mito_carr 141..229 CDD:278578 24/101 (24%)
Mito_carr 235..322 CDD:278578 21/93 (23%)
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 20/96 (21%)
PTZ00169 18..296 CDD:240302 63/294 (21%)
Mito_carr 109..205 CDD:278578 23/102 (23%)
Mito_carr 208..300 CDD:278578 21/94 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442026
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.