DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and CG7514

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:283 Identity:56/283 - (19%)
Similarity:112/283 - (39%) Gaps:62/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VNIAVTYPIYKMIFRQMLHGVPITSAFAQLRHEGLGFLYRGMLPPLAQKTISLSIMFGVFDGTRR 130
            :.|:.|...||..|..:|         ...::||:..||.|:...|.::....:...|.:    :
  Fly    40 MQISATTGEYKSSFDCLL---------KVFKNEGILALYNGLSAGLMRQATYTTARMGFY----Q 91

  Fly   131 YLVEDYR---------LNDYGAKVLA----AVVAGSAESILLPFERVQTLLADSKF----HQHFS 178
            ..::.||         |...|..:||    |:....||..|:      .:::|::.    .::::
  Fly    92 MEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALI------RMMSDNRLPPAERRNYT 150

  Fly   179 NTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSNALFFVLREEASVRLPKRKSVSTRTVQEF---- 239
            ...|||..:|...|...|::|..|...|..:.|          .|:|.....:.....:.|    
  Fly   151 GVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVN----------MVQLASYSQLKAAFSEYFSGLS 205

  Fly   240 --IAGAVIGASISTI-FYPLNVIKVSLQSEMGQRSEGSWQACKRIYVERDRRIGNFYRG-CPF-- 298
              ||.|::...::|| ..||::.|..:|.:.....:|:.....:  |.::..|.:.::| .|:  
  Fly   206 LHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMK--VSKNEGIASLWKGFTPYLC 268

  Fly   299 ----NTGRSFISWGIMNTAYENL 317
                :|..:||....:..||:::
  Fly   269 RLGPHTVFAFIFLEQLTKAYKHI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 13/69 (19%)
Mito_carr 141..229 CDD:278578 20/95 (21%)
Mito_carr 235..322 CDD:278578 20/97 (21%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 54/277 (19%)
Mito_carr 19..90 CDD:278578 13/58 (22%)
Mito_carr 104..201 CDD:278578 21/112 (19%)
Mito_carr 207..284 CDD:278578 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442025
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.