DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and Tpc2

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:302 Identity:69/302 - (22%)
Similarity:122/302 - (40%) Gaps:45/302 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GAAFVNIAVTYPIYKMIFRQMLHGVPITS-----------AFAQL-RHEGLGFLYRGMLPPLAQK 114
            |||...|.....:.|:.|:..:.  |:|:           ||..: ..||:..::||   ..:.:
  Fly    20 GAATRTITQPLDVLKIRFQMQVE--PVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRG---HNSGQ 79

  Fly   115 TISLS---IMFGVFDGTRRYLVE-DY-RLNDYGAKVLAAVVAGSAESILL-PFE--RVQTLLADS 171
            .:|:|   :.|..::..|....: || |...:....:...:||...::.. ||:  |.|.:.||.
  Fly    80 VLSISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGAVAAQPFDVVRTQMVAADP 144

  Fly   172 KFHQHFSNTQNAFRYVVSHHGYRELYRGLE----PVFWRNGLSNALFF-VLREEASVRLPKRKSV 231
            ...:...||....|.|....|:..|.|||.    .||...| :|.||: .|.....:..|..:..
  Fly   145 SSRRSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQVFPLVG-ANFLFYKYLNAAVLMAKPPDQRQ 208

  Fly   232 STRTVQEFIAGAVIGASISTIFYPLNVIKVSLQ---SEMGQRSEGSWQACKRIY-----VERDRR 288
            .......|:.||:.|.....|.||.:::|..:|   .:..:::.|....|..|.     ..|:..
  Fly   209 EIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPECPTILGCITTTFREEG 273

  Fly   289 IGNFYRG-CPFNTGRSFISWGIMNTAYENLKKLMQQQPPLPL 329
            ||.||:| .|     :.:..|:|:..|.::..:.::....|:
  Fly   274 IGGFYKGMLP-----TLLKAGLMSAVYFSIYDMFKRHYIAPM 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 18/89 (20%)
Mito_carr 141..229 CDD:278578 25/95 (26%)
Mito_carr 235..322 CDD:278578 22/95 (23%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 65/291 (22%)
Mito_carr 23..99 CDD:278578 15/80 (19%)
Mito_carr 108..194 CDD:278578 23/86 (27%)
Mito_carr 216..307 CDD:278578 22/95 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.