DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and Tyler

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster


Alignment Length:253 Identity:49/253 - (19%)
Similarity:83/253 - (32%) Gaps:75/253 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GCGAAFVNIAVTYPIYKMIFRQMLHGVPITSAFAQLRHEGLGFLYRGMLPPLAQKTISLSIMFGV 124
            |...|||.|..|                          .|...|:.|:.|.|.....|..|.|..
  Fly   123 GAMDAFVKIVCT--------------------------SGFSGLWAGLSPTLVSALPSTIIYFLT 161

  Fly   125 FDGTRR-----YLV----EDYRLNDY---------------GAKVLAAVVAGSAE---------- 155
            ::..:.     |||    |:..:.|.               |..|.|.....:|.          
  Fly   162 YEYIKNSLSH
IYLVSQKFEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASG 226

  Fly   156 --------SILLPFERVQTLLADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSNA 212
                    :.:.|.|.|:..:...  :..::......|.::..||...|:||..|...|:...:.
  Fly   227 ICSRTIVVTAITPIEMVRIKMQSE--YMTYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSG 289

  Fly   213 LFFVLREEASVRLPKRKSVSTRT-VQEFIAGAVIGASISTIFYPLNVIKVSLQSEMGQ 269
            .::.:.|    .:.:..||:..| :..|:.||:.||..:.:..|.::|....|.|:||
  Fly   290 TYWAVYE----AIKRAF
SVTEPTFLFSFLTGAISGAVATFVTMPFDLITTHTQIELGQ 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 18/84 (21%)
Mito_carr 141..229 CDD:278578 16/120 (13%)
Mito_carr 235..322 CDD:278578 12/36 (33%)
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 14/73 (19%)
Mito_carr 216..302 CDD:278578 12/91 (13%)
Mito_carr 306..429 CDD:278578 12/38 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441478
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.