Sequence 1: | NP_651766.1 | Gene: | CG7943 / 43574 | FlyBaseID: | FBgn0039741 | Length: | 332 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_608327.2 | Gene: | Tyler / 3772349 | FlyBaseID: | FBgn0031038 | Length: | 441 | Species: | Drosophila melanogaster |
Alignment Length: | 253 | Identity: | 49/253 - (19%) |
---|---|---|---|
Similarity: | 83/253 - (32%) | Gaps: | 75/253 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 GCGAAFVNIAVTYPIYKMIFRQMLHGVPITSAFAQLRHEGLGFLYRGMLPPLAQKTISLSIMFGV 124
Fly 125 FDGTRR-----YLV----EDYRLNDY---------------GAKVLAAVVAGSAE---------- 155
Fly 156 --------SILLPFERVQTLLADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSNA 212
Fly 213 LFFVLREEASVRLPKRKSVSTRT-VQEFIAGAVIGASISTIFYPLNVIKVSLQSEMGQ 269 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7943 | NP_651766.1 | Mito_carr | 54..136 | CDD:278578 | 18/84 (21%) |
Mito_carr | 141..229 | CDD:278578 | 16/120 (13%) | ||
Mito_carr | 235..322 | CDD:278578 | 12/36 (33%) | ||
Tyler | NP_608327.2 | Mito_carr | 41..171 | CDD:278578 | 14/73 (19%) |
Mito_carr | 216..302 | CDD:278578 | 12/91 (13%) | ||
Mito_carr | 306..429 | CDD:278578 | 12/38 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45441478 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |