DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and sea

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:294 Identity:66/294 - (22%)
Similarity:114/294 - (38%) Gaps:61/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VNIAVTYPI-----------------YKMIFRQMLHGVPITSAFAQLRHEGLGFLYRGMLPPLAQ 113
            :.|.:|||.                 |..||..:...|. ...|..| :.||..|..|.:|..|.
  Fly    46 IEICITYPTEYVKTQLQLDEKGAAKKYNGIFDCVKKTVG-ERGFLGL-YRGLSVLVYGSIPKSAA 108

  Fly   114 KTISLSIMFGVFDGTRRYLVEDYRLNDYGAKVLAAVVAGSAESI--LLPFERVQTLLADSKFHQH 176
            :       ||.|:..:...|:.........|:|..:.||..|:|  :.|.|.::.         .
  Fly   109 R-------FGAFEFLKSNAVDSRGQLSNSGKLLCGLGAGVCEAIVAVTPMETIKV---------K 157

  Fly   177 FSNTQNA----FR-------YVVSHHGYRELYRGLEPVFWRNGLSNAL-FFVLREEASVRLPKRK 229
            |.|.|.:    ||       .::...|...:|:||.|...:.|.:.|: ||||.   |::...:.
  Fly   158 FINDQRSGNPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLE---SLKDLYKG 219

  Fly   230 SVSTRTVQEFIA---GAVIGASISTIF--YPLNVIKVSLQSEMGQRSEGSWQACKRIYVERDRRI 289
            ...|:.|.:.:.   ||:.||  :::|  .||:|:|..:|.....:.:.:  |...:.:.::...
  Fly   220 DDHTKPVPKLVVGVFGAIAGA--ASVFGNTPLDVVKTRMQGLEASKYKNT--AHCAVEILKNEGP 280

  Fly   290 GNFYRGCPFNTGRSFISWGIMNTAYENLKKLMQQ 323
            ..||:|.....||..:...|....|::...|..:
  Fly   281 AAFYKGTVPRLGRVCLDVAITFMIYDSFMDLFNK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 20/86 (23%)
Mito_carr 141..229 CDD:278578 25/101 (25%)
Mito_carr 235..322 CDD:278578 20/91 (22%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 64/280 (23%)
Mito_carr 34..117 CDD:278578 19/79 (24%)
Mito_carr 125..220 CDD:278578 25/106 (24%)
Mito_carr 235..314 CDD:278578 19/82 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442028
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.