DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and CG18324

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster


Alignment Length:206 Identity:43/206 - (20%)
Similarity:75/206 - (36%) Gaps:44/206 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SVFSKRFFGSFQWEEFACGC-GAAFVNIAVTYPIYKMIFRQMLHGVPITSAFAQLRH-------- 97
            |.:...|||:..      || |..|.:     |.|.:..:|....|...:...|.:|        
  Fly   104 SFYRGMFFGALG------GCTGTYFAS-----PFYMIKAQQHAQAVQSIAVGFQHKHTSMMDALL 157

  Fly    98 -----EGLGFLYRGMLPPLAQKTISLSIMFGVFDGTRRYLVEDYRLNDYG---AKVLAAVVAGSA 154
                 .|:...:|..||.|.:..::.|:..|.|...:..      |.|.|   ..||.:..||.:
  Fly   158 HIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKSL------LKDKGWITHPVLLSFCAGLS 216

  Fly   155 ESILL-----PFERVQTLLADSKFHQH-----FSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGL 209
            ...|:     ||:.:.|.:.:....:.     :....:.|..:....|...:|:|..|:::|:..
  Fly   217 SGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKIWRTEGIHGMYKGFWPIYFRSAP 281

  Fly   210 SNALFFVLREE 220
            ...|.||..|:
  Fly   282 HTTLTFVFFEK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 18/95 (19%)
Mito_carr 141..229 CDD:278578 19/93 (20%)
Mito_carr 235..322 CDD:278578
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578
PTZ00169 5..293 CDD:240302 43/206 (21%)
Mito_carr 101..201 CDD:278578 24/113 (21%)
Mito_carr 204..296 CDD:278578 18/89 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441331
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.