DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and Dic3

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:173 Identity:38/173 - (21%)
Similarity:63/173 - (36%) Gaps:42/173 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YKMIFRQMLHGVPITSAFAQLRHEGLGFLYRGMLPPLAQKTI--------------SLSIMFGVF 125
            ||.:|         ...|...:.||:..|:||.:|.:::..:              .|.|..|..
  Fly   139 YKHVF---------DGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAG 194

  Fly   126 DGTRRYLVEDYRLNDYGAKVLAAVVAGS-AESILLPFERVQTLLADSKFHQHFSNTQNAFRYVVS 189
            :|...:..             .:.:||. |..|..|.:.::|...::: ...||....|| ...:
  Fly   195 EGVPLHFA-------------TSTIAGCIAVVITQPLDVIKTTFMNAQ-PGEFSGIGGAF-LSTA 244

  Fly   190 HHGYRELYRGLEPVFWRNGLSNALFFVLREEASVR---LPKRK 229
            ..|....|:|..|...|...:..:.|||.|:|.:|   ||..|
  Fly   245 KQGPLAFYKGFIPALIRVSPNTIITFVLYEQARMRFGYLPPDK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 14/74 (19%)
Mito_carr 141..229 CDD:278578 23/91 (25%)
Mito_carr 235..322 CDD:278578
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 32/159 (20%)
Mito_carr 15..91 CDD:278578
Mito_carr 93..187 CDD:278578 10/56 (18%)
Mito_carr 200..281 CDD:278578 21/95 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441891
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.