DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and CG4995

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:262 Identity:64/262 - (24%)
Similarity:99/262 - (37%) Gaps:59/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LYRGMLPPLAQKTISLSIMFGVFDGTRRYLVEDYRLNDYGAKVLAAVVAGSAES-ILLPFERVQT 166
            ||||:..|:....:..:|:|||:...:| |..|  .|...:...|..:||.|:. :..|.|..:|
  Fly    97 LYRGISSPMGGIGLVNAIVFGVYGNVQR-LSND--PNSLTSHFFAGSIAGVAQGFVCAPMELAKT 158

  Fly   167 LL-----ADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSNALFFVLREEASVRLP 226
            .|     .||..  .|:...:..:|:|...|.|..::||.....|:....|.:||     |....
  Fly   159 RLQLSTQVDSGI--KFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFV-----SFEYL 216

  Fly   227 KRKSVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSLQSE----------------MGQRSEGSW 275
            .|:..:.......:||...|.|.....||::|:|..:|::                .|.|:||..
  Fly   217 MRQVETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNEGPQ 281

  Fly   276 QACKRIYVERDRRIGNFYRGC--------PFNTGRSF-ISW--GIMNTAYENLKKLMQQQPPLPL 329
            .               |:||.        |.|....| :||  .|.| |...:..:|....||.|
  Fly   282 Y---------------FFRGLNSTLIRAFPMNAACFFVVSWVLDICN-AKGGMDSVMHSDQPLTL 330

  Fly   330 AS 331
            .:
  Fly   331 VN 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 11/32 (34%)
Mito_carr 141..229 CDD:278578 22/93 (24%)
Mito_carr 235..322 CDD:278578 24/113 (21%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 10/28 (36%)
PTZ00169 41..295 CDD:240302 52/222 (23%)
Mito_carr 128..218 CDD:278578 24/98 (24%)
Mito_carr 221..304 CDD:278578 18/97 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441398
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.