DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and CG9582

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster


Alignment Length:300 Identity:60/300 - (20%)
Similarity:120/300 - (40%) Gaps:45/300 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 WEEFACGCGAAFVNIAVTYPIYKMIFRQMLHGV-----------PITSAFAQLRHEGLGFLYRGM 107
            | :|..|..:.|:.|...:|:..:..|..:.|.           |:.:.....|:|||..|::|:
  Fly    15 W-QFLAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKIYRYEGLSSLWKGI 78

  Fly   108 LPPLAQKTISLSIMFGVFDGTRRYLVEDYRLNDYGA-------KVLAAVVAGSAESILL-PFERV 164
            :||:..:|......|.:::..:.|.       .:||       ..::..:|...||.|: |||.|
  Fly    79 VPPICVETPKRGGKFLMYESLKPYF-------QFGAPQPTPLTHAMSGSMAAILESFLVNPFEVV 136

  Fly   165 QTLLADSKFHQHFSNTQNAFRYVVSHHGY--RELYRGLEPVFWRNGLSNALFFVLREEASVRLPK 227
            :  :...........|.:..:|::.|.||  :.||||:..:..||.:.:..||.........:|.
  Fly   137 K--ITQQAHRGKRLKTLSVVKYIIKHDGYGIKGLYRGITALVARNAVFHFGFFGFYNALKDIVPS 199

  Fly   228 RKSVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSLQSEMGQRSEGSWQ----ACKRIYVERDRR 288
            .:..:...:::.|...:..:....:...|::.|..:|.....:.|..:|    ..|..:.|...|
  Fly   200 PEDKTYNILRKVIIAGLASSLACVMSVTLDMAKCRIQGPQPVKGEVKYQWTISTIKSTFKEEGFR 264

  Fly   289 IGNFYRGCPFNTGRSFISWG----IMNTAYENLKKLMQQQ 324
              :.::|    .|...:..|    ::...||.|.:.::.|
  Fly   265 --SLFKG----LGAMILRVGPGGAMLLVTYEYLFEFLKSQ 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 20/92 (22%)
Mito_carr 141..229 CDD:278578 24/97 (25%)
Mito_carr 235..322 CDD:278578 15/94 (16%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 58/293 (20%)
Mito_carr 17..104 CDD:278578 19/93 (20%)
Mito_carr 109..196 CDD:278578 21/88 (24%)
Mito_carr 216..295 CDD:278578 14/84 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442035
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.