DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and Ucp4C

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster


Alignment Length:234 Identity:52/234 - (22%)
Similarity:93/234 - (39%) Gaps:55/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 TRRYLVEDYRLNDYGAKVLAAVVAGSAESILLPFERVQT-LLADSKFHQHFSNTQNAFRYVVSH- 190
            |.|.|.:.| :|.:       :.|..|||.:.|.:..:| :..|.:..:........||..::: 
  Fly    32 TARNLFQLY-VNTF-------IGANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNM 88

  Fly   191 ---HGYRELYRGLEPVFWRNGLSNALFFVL-------------REEASVRLPKRKSVSTRTVQEF 239
               .|::.||.|...:..||.:.|:|..||             |.|..:::......|      |
  Fly    89 IRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCS------F 147

  Fly   240 IAGAVIGASISTIFYPLNVIKVSLQSEMGQRSEGSW----QACKRIYVERDRRIG---------- 290
            .||.:..|    :..|.:::||.:|:| |:|.:..:    .:..:.:|:..||.|          
  Fly   148 TAGCIAQA----LANPFDIVKVRMQTE-GRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGP 207

  Fly   291 NFYRGCPFNTGRSFISWGIMNTAYENLKKLMQQQPPLPL 329
            :..|.|...||    ..|..:.:....|:|:..:..|||
  Fly   208 SCMRACLMTTG----DVGSYDISKRTFKRLLDLEEGLPL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 3/7 (43%)
Mito_carr 141..229 CDD:278578 21/105 (20%)
Mito_carr 235..322 CDD:278578 22/100 (22%)
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 18/74 (24%)
Mito_carr 137..232 CDD:278578 21/109 (19%)
Mito_carr 237..329 CDD:278578 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.