DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and colt

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:215 Identity:51/215 - (23%)
Similarity:92/215 - (42%) Gaps:29/215 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PIYKMIFRQMLHGVPITSAFAQLRHEGLGFLYRGMLPPLAQKTISLSIMF-GVFDGTR-RYLVED 135
            |:|:..|         ..|...:::||:..||:||..||.......::.| |...|.| :...||
  Fly    55 PLYRGTF---------DCAAKTIKNEGVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQRGED 110

  Fly   136 YRLNDYGAKVLAAVVAGSAESILL-PFERVQTLL-------ADSKFHQHFSNTQNAFRYVVSHHG 192
            .:|. |....:|...:|...:::: |.||::.||       .:.|::.........::    ..|
  Fly   111 AKLT-YPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQGQGGERKYNGMIDCAGKLYK----EGG 170

  Fly   193 YRELYRGLEPVFWRNGLSNALFFVLREE-ASVRLPKRKSVSTRTVQEFIAGAVIGASISTIFYPL 256
            .|.:::|......|:..:|.|:|::.|. ..|...|.::....|.....||.|.|.:...:..|.
  Fly   171 LRSVFKGSCATMLRDLPANGLYFLVYEALQDVAKSKSETGQISTASTIFAGGVAGMAYWILGMPA 235

  Fly   257 NVIKVSLQSEMGQRSEGSWQ 276
            :|:|..|||    ..||:::
  Fly   236 DVLKSRLQS----APEGTYK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 17/64 (27%)
Mito_carr 141..229 CDD:278578 19/96 (20%)
Mito_carr 235..322 CDD:278578 13/42 (31%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 16/60 (27%)
Mito_carr 112..202 CDD:395101 18/94 (19%)
Mito_carr 210..299 CDD:395101 13/46 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441738
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.