DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and Ant2

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:248 Identity:50/248 - (20%)
Similarity:83/248 - (33%) Gaps:82/248 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 VLAAVVAGSAESILLPFERVQTLL----------ADSKFHQHFSNTQNAFRYVVSHHGYRELYRG 199
            ::..|.|..|::.:.|.|||:.:|          ||    |.:....:.|..:....|:..    
  Fly    23 MMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAAD----QRYKGIVDCFIRIPKEQGFSS---- 79

  Fly   200 LEPVFWRNGLSN--------ALFFVLRE-EASVRL---PKRKSVSTRTVQEFIAGAVIGASISTI 252
                |||..|:|        ||.|..:: ..||.|   .|.|...........:|...||:....
  Fly    80 ----FWRGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCF 140

  Fly   253 FYPLNVIKVSLQSEMGQRSEGSWQA---CKRIYVERDRRIG--------------------NFYR 294
            .|||:..:..|.:::|:.....:..   |....::.|..||                    .||.
  Fly   141 VYPLDFARTRLAADVGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYD 205

  Fly   295 GC----------PFNTGRSFISW----------GIMNTAYENLKKLMQQQPPL 327
            .|          ||     ::||          ||.:..::.:::.|..|..|
  Fly   206 TCRDFLPNPKSTPF-----YVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578
Mito_carr 141..229 CDD:278578 25/105 (24%)
Mito_carr 235..322 CDD:278578 21/129 (16%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 50/248 (20%)
Mito_carr 17..111 CDD:278578 23/99 (23%)
Mito_carr 119..215 CDD:278578 15/95 (16%)
Mito_carr 218..307 CDD:278578 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442033
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.