DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7943 and Slc25a52

DIOPT Version :9

Sequence 1:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_223434.3 Gene:Slc25a52 / 305365 RGDID:1309563 Length:300 Species:Rattus norvegicus


Alignment Length:312 Identity:124/312 - (39%)
Similarity:177/312 - (56%) Gaps:23/312 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DPPPPKRFPSGRAHSPHGDGEAGKLLHGSVFSKRFFGSFQWEEFACGCGAAFVNIAVTYPIYKMI 78
            |..||....|.:..||| ..:.|::.|                :.|||.|||.|:|:|||:.|:.
  Rat     8 DKRPPMLTSSNQDLSPH-LADVGQIKH----------------YFCGCCAAFNNVAITYPVQKIF 55

  Fly    79 FRQMLHGVPITSAFAQLRHEGLGFLYRGMLPPLAQKTISLSIMFGVFDGTRRYLVEDYRLN--DY 141
            |||.|:.:....|..|||.:|...||||:.|||.|||.:|::|||:::.. ..|:..:..|  ::
  Rat    56 FRQQLYRIKTWDAILQLRKDGFRNLYRGIFPPLMQKTTTLALMFGLYEDL-SCLLRKHVSNAPEF 119

  Fly   142 GAKVLAAVVAGSAESILLPFERVQTLLADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWR 206
            ..:.:||::|.:.|:||.|.||||||..|.|....|:||..||| .:..||..|.||||.|:.:|
  Rat   120 ATRSVAALLARTTEAILTPLERVQTLFQDHKHRDKFTNTYQAFR-ALRCHGVAEYYRGLVPILFR 183

  Fly   207 NGLSNALFFV--LREEASVRLPKRKSVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSLQSEMGQ 269
            ||.||.|||.  ||......||...:.|...|.:||.|.|:||.:..:.:|:||:|..:||::|.
  Rat   184 NGFSNILFFFFGLRGPIKEHLPTATTQSAHLVNDFICGGVLGAMLGFLSFPVNVVKARIQSQIGG 248

  Fly   270 RSEGSWQACKRIYVERDRRIGNFYRGCPFNTGRSFISWGIMNTAYENLKKLM 321
            ..:......|.|::||||::.|.:||...|..||.|||||:|..||.|.|::
  Rat   249 PFQSLPMVFKTIWIERDRKLINLFRGAHLNHHRSLISWGIINATYEFLLKIV 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 36/81 (44%)
Mito_carr 141..229 CDD:278578 41/89 (46%)
Mito_carr 235..322 CDD:278578 36/87 (41%)
Slc25a52XP_223434.3 Mito_carr 31..112 CDD:395101 37/97 (38%)
PTZ00168 78..>241 CDD:185494 69/164 (42%)
Mito_carr 210..299 CDD:395101 36/88 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H88487
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D503015at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.